Recombinant Human IFNA1 protein, GST-tagged
Cat.No. : | IFNA1-30165H |
Product Overview : | Recombinant Human IFNA1 (24-189 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Cys24-Glu189 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | IFNA1 interferon, alpha 1 [ Homo sapiens ] |
Official Symbol | IFNA1 |
Synonyms | IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507; |
Gene ID | 3439 |
mRNA Refseq | NM_024013 |
Protein Refseq | NP_076918 |
MIM | 147660 |
UniProt ID | P01562 |
◆ Recombinant Proteins | ||
IFNA1-07H | Recombinant Human IFNA1 protein | +Inquiry |
IFNA1-8025M | Recombinant Mouse IFNA1 Protein | +Inquiry |
Ifna1-487R | Recombinant Rat Ifna1 protein, His-tagged | +Inquiry |
IFNA1-636G | Recombinant Guinea pig IFNA1 protein, His & T7-tagged | +Inquiry |
IFNA1-634C | Recombinant Chicken IFNA1 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA1-1513RCL | Recombinant Rat IFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA1 Products
Required fields are marked with *
My Review for All IFNA1 Products
Required fields are marked with *