Recombinant Human IFNA14 Protein (24-189 aa), His-tagged
| Cat.No. : | IFNA14-1423H |
| Product Overview : | Recombinant Human IFNA14 Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 24-189 aa |
| Description : | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 21.7 kDa |
| AA Sequence : | CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | IFNA14 interferon, alpha 14 [ Homo sapiens ] |
| Official Symbol | IFNA14 |
| Synonyms | IFNA14; LEIF2H; leIF H; IFN-alpha-14; IFN-alphaH; MGC125756; MGC125757; |
| Gene ID | 3448 |
| mRNA Refseq | NM_002172 |
| Protein Refseq | NP_002163 |
| MIM | 147579 |
| UniProt ID | P01570 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA14 Products
Required fields are marked with *
My Review for All IFNA14 Products
Required fields are marked with *



