Recombinant Human IFNA14 Protein (24-189 aa), His-tagged
Cat.No. : | IFNA14-1423H |
Product Overview : | Recombinant Human IFNA14 Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-189 aa |
Description : | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.7 kDa |
AA Sequence : | CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | IFNA14 interferon, alpha 14 [ Homo sapiens ] |
Official Symbol | IFNA14 |
Synonyms | IFNA14; LEIF2H; leIF H; IFN-alpha-14; IFN-alphaH; MGC125756; MGC125757; |
Gene ID | 3448 |
mRNA Refseq | NM_002172 |
Protein Refseq | NP_002163 |
MIM | 147579 |
UniProt ID | P01570 |
◆ Recombinant Proteins | ||
Ifna14-1649M | Recombinant Mouse Ifna14 Protein, His-tagged | +Inquiry |
IFNA14-072H | Recombinant Human IFNA14 Protein | +Inquiry |
IFNA14-125R | Active Recombinant Rhesus IFNA14 protein, His-tagged | +Inquiry |
IFNA14-43H | Recombinant Human Interferon, Alpha 14 | +Inquiry |
IFNA14-146H | Recombinant Human Interferon, Alpha 14, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA14-902MCL | Recombinant Mouse IFNA14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA14 Products
Required fields are marked with *
My Review for All IFNA14 Products
Required fields are marked with *
0
Inquiry Basket