Recombinant Human IFNA14 Protein (24-189 aa), His-tagged

Cat.No. : IFNA14-1423H
Product Overview : Recombinant Human IFNA14 Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 24-189 aa
Description : Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.7 kDa
AA Sequence : CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name IFNA14 interferon, alpha 14 [ Homo sapiens ]
Official Symbol IFNA14
Synonyms IFNA14; LEIF2H; leIF H; IFN-alpha-14; IFN-alphaH; MGC125756; MGC125757;
Gene ID 3448
mRNA Refseq NM_002172
Protein Refseq NP_002163
MIM 147579
UniProt ID P01570

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNA14 Products

Required fields are marked with *

My Review for All IFNA14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon