Recombinant Human IFNA14 Protein, His-SUMO-tagged
Cat.No. : | IFNA14-1253H |
Product Overview : | Recombinant Human IFNA14 Protein (24-189aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-189 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFST KNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCA WEVVRAEIMRSLSFSTNLQKRLRRKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | IFNA14 interferon, alpha 14 [ Homosapiens ] |
Official Symbol | IFNA14 |
Synonyms | IFNA14; interferon, alpha 14; LEIF2H;MGC125756; MGC125757; interferon alpha 14; interferon alpha-14; Interferonalpha-H; Interferon lambda-2-H; LeIF H; IFN-alpha-14; OTTHUMP00000021139 |
Gene ID | 3448 |
mRNA Refseq | NM_002172 |
Protein Refseq | NP_002163 |
MIM | 147579 |
UniProt ID | P01570 |
◆ Recombinant Proteins | ||
Ifna14-121M | Active Recombinant Mouse Ifna14, Fc-tagged | +Inquiry |
Ifna14-1649M | Recombinant Mouse Ifna14 Protein, His-tagged | +Inquiry |
IFNA14-1423H | Recombinant Human IFNA14 Protein (24-189 aa), His-tagged | +Inquiry |
Ifna14-60M | Recombinant Mouse Ifna14, Fc tagged | +Inquiry |
IFNA14-224M | Recombinant Mouse IFNA14, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA14-902MCL | Recombinant Mouse IFNA14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA14 Products
Required fields are marked with *
My Review for All IFNA14 Products
Required fields are marked with *