Recombinant Human IFNA16 protein, His-tagged
Cat.No. : | IFNA16-7443H |
Product Overview : | Recombinant Human IFNA16 protein(P05015)(24-189aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-189aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD |
Gene Name | IFNA16 interferon, alpha 16 [ Homo sapiens ] |
Official Symbol | IFNA16 |
Synonyms | IFNA16; interferon, alpha 16; interferon alpha-16; IFN alphaO; IFN-alpha-16; IFN-alpha-N-protein; interferon alpha-WA; IFN-alphaO; |
Gene ID | 3449 |
mRNA Refseq | NM_002173 |
Protein Refseq | NP_002164 |
MIM | 147580 |
UniProt ID | P05015 |
◆ Recombinant Proteins | ||
Ifna16-1650M | Recombinant Mouse Ifna16 Protein, His&GST-tagged | +Inquiry |
IFNA16-1425H | Recombinant Human IFNA16 protein, His-tagged | +Inquiry |
IFNA16-46H | Recombinant Human Interferon, Alpha 16 | +Inquiry |
IFNA16-073H | Recombinant Human IFNA16 Protein | +Inquiry |
IFNA16-7443H | Recombinant Human IFNA16 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA16-836HCL | Recombinant Human IFNA16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA16 Products
Required fields are marked with *
My Review for All IFNA16 Products
Required fields are marked with *
0
Inquiry Basket