Recombinant human IFNA2, Active, His-tagged
Cat.No. : | IFNA2-1554H |
Product Overview : | Recombinant human IFN-alpha-2a is a polypeptide single chain containing 171 amino acids with a predicted molecular mass of 20.1 kDa. Recombinant human IFN-alpha-2 contains a His-tag at the C-terminal end. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | His |
Protein Length : | 171 a.a. |
Description : | Interferon alpha 2a is an interferon class I produced by the cells of the innate immune system as a part of the defense response to foreign agents such as viruses, parasites and tumour cells. The human alpha-interferon family displays broad spectrum antiviral, antiproliferative and immunomodulatory activities on a variety of cell types. Interferon Alpha-2a (IFNa-2a), one of the subtypes, is a protein consisting of 165 amino acid. Its three-dimensional loop structure is maintained by two disulphide bridges. It has an approximate molecular weight of 20 kDa. |
Form : | Recombinant human Interferon alpha 2a is lyophilized from a Tris HCl 0.05M buffer at pH 7.4 and 0.01% SDS. |
Molecular Mass : | 20.1 kDa |
AA Sequence : | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAA WDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRS FSLSTNLQESLRSKEHHHHHH |
Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : | Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines. |
Gene Name | IFNA2 interferon, alpha 2 [ Homo sapiens ] |
Official Symbol | IFNA2 |
Synonyms | IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765; |
Gene ID | 3440 |
mRNA Refseq | NM_000605 |
Protein Refseq | NP_000596 |
MIM | 147562 |
UniProt ID | P01563 |
Chromosome Location | 9p22 |
Pathway | Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; |
Function | cytokine activity; interferon-alpha/beta receptor binding; protein binding; |
◆ Recombinant Proteins | ||
IFNA2-113H | Active Recombinant Human IFN-alpha 2a Protein | +Inquiry |
IFNA2-0256H | Active Recombinant Human IFNA2 protein, Fc-tagged | +Inquiry |
IFNA2-29498TH | Recombinant Human IFNA2 | +Inquiry |
IFNA2-2270H | Recombinant Human IFNA2 Protein, His-tagged | +Inquiry |
IFNA2-2499H | Recombinant Human IFNA2 Protein (Cys24-Glu188), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
IFNA2-1634MCL | Recombinant Mouse IFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA2 Products
Required fields are marked with *
My Review for All IFNA2 Products
Required fields are marked with *
0
Inquiry Basket