Recombinant Human IFNA21 protein, His-tagged
Cat.No. : | IFNA21-3069H |
Product Overview : | Recombinant Human IFNA21 protein(P01568)(24-189aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-189aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IFNA21 interferon, alpha 21 [ Homo sapiens ] |
Official Symbol | IFNA21 |
Synonyms | IFNA21; interferon, alpha 21; interferon alpha-21; IFN alphaI; leukocyte interferon protein; IFN-alpha-21; interferon alpha-F; LeIF F; leIF-F; IFN-alphaI; MGC126687; MGC126689; |
Gene ID | 3452 |
mRNA Refseq | NM_002175 |
Protein Refseq | NP_002166 |
MIM | 147584 |
UniProt ID | P01568 |
◆ Recombinant Proteins | ||
IFNA21-3069H | Recombinant Human IFNA21 protein, His-tagged | +Inquiry |
IFNA21-3100H | Recombinant Human IFNA21 Protein (Asp25-Glu189), N-GST tagged | +Inquiry |
IFNA21-6275H | Recombinant Human IFNA21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFNA21-617H | Recombinant Human IFNA21 Protein, His/GST-tagged | +Inquiry |
IFNA21-77H | Recombinant Human Interferon, Alpha 21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA21-5280HCL | Recombinant Human IFNA21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNA21 Products
Required fields are marked with *
My Review for All IFNA21 Products
Required fields are marked with *