Recombinant Human IFNA21 protein, His-tagged

• Cat.No.: IFNA21-3069H
• Product Overview: Recombinant Human IFNA21 protein(P01568)(24-189aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 24-189aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 23.3 kDa
• AA Sequence: CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: IFNA21 interferon, alpha 21 [ Homo sapiens ]
• Official Symbol: IFNA21
• Synonyms: IFNA21; interferon, alpha 21; interferon alpha-21; IFN alphaI; leukocyte interferon protein; IFN-alpha-21; interferon alpha-F; LeIF F; leIF-F; IFN-alphaI; MGC126687; MGC126689
• Gene ID: 3452
• mRNA Refseq: NM_002175
• Protein Refseq: NP_002166
• MIM: 147584
• UniProt ID: P01568