| Species : |
Human |
| Source : |
Wheat Germ |
| Tag : |
Non |
| Protein Length : |
557 amino acids |
| Description : |
The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. |
| Molecular Weight : |
87.340kDa inclusive of tags |
| Tissue specificity : |
IFN receptors are present in all tissues and even on the surface of most IFN-resistant cells. Isoform 1, isoform 2 and isoform 3 are expressed in the IFN-alpha sensitive myeloma cell line U266S. Isoform 2 and isoform 3 are expressed in the IFN-alpha resis |
| Form : |
Liquid |
| Purity : |
Proprietary Purification |
| Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDI IDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQ NITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSF TPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDG LSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCL KVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQ NQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQI PDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSE EIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTP VIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLT VYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLI VGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDE YFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQT DEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV |
| Sequence Similarities : |
Belongs to the type II cytokine receptor family.Contains 3 fibronectin type-III domains. |