Recombinant Human IFNAR1

Cat.No. : IFNAR1-29420TH
Product Overview : Recombinant fragment corresponding to amino acids 28-127 of Human IFNAR1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : IFN receptors are present in all tissues and even on the surface of most IFN-resistant cells. Isoform 1, isoform 2 and isoform 3 are expressed in the IFN-alpha sensitive myeloma cell line U266S. Isoform 2 and isoform 3 are expressed in the IFN-alpha resis
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQ
Sequence Similarities : Belongs to the type II cytokine receptor family.Contains 3 fibronectin type-III domains.
Gene Name IFNAR1 interferon (alpha, beta and omega) receptor 1 [ Homo sapiens ]
Official Symbol IFNAR1
Synonyms IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC;
Gene ID 3454
mRNA Refseq NM_000629
Protein Refseq NP_000620
MIM 107450
Uniprot ID P17181
Chromosome Location 21q22.1
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; Hepatitis C, organism-specific biosystem;
Function receptor activity; type I interferon receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNAR1 Products

Required fields are marked with *

My Review for All IFNAR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon