Recombinant Human IFNAR1
Cat.No. : | IFNAR1-29420TH |
Product Overview : | Recombinant fragment corresponding to amino acids 28-127 of Human IFNAR1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | IFN receptors are present in all tissues and even on the surface of most IFN-resistant cells. Isoform 1, isoform 2 and isoform 3 are expressed in the IFN-alpha sensitive myeloma cell line U266S. Isoform 2 and isoform 3 are expressed in the IFN-alpha resis |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQ |
Sequence Similarities : | Belongs to the type II cytokine receptor family.Contains 3 fibronectin type-III domains. |
Gene Name | IFNAR1 interferon (alpha, beta and omega) receptor 1 [ Homo sapiens ] |
Official Symbol | IFNAR1 |
Synonyms | IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC; |
Gene ID | 3454 |
mRNA Refseq | NM_000629 |
Protein Refseq | NP_000620 |
MIM | 107450 |
Uniprot ID | P17181 |
Chromosome Location | 21q22.1 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; Hepatitis C, organism-specific biosystem; |
Function | receptor activity; type I interferon receptor activity; |
◆ Recombinant Proteins | ||
IFNAR1-11H | Active Recombinant Human IFNAR1 Protein | +Inquiry |
IFNAR1-6422C | Recombinant Chicken IFNAR1 | +Inquiry |
Ifnar1-6940R | Recombinant Rat Ifnar1 protein, His-tagged | +Inquiry |
IFNAR1-80C | Recombinant Cynomolgus IFNAR1, LEVLFQ tagged | +Inquiry |
IFNAR1-946H | Recombinant Human IFNAR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNAR1-1643HCL | Recombinant Human IFNAR1 cell lysate | +Inquiry |
IFNAR1-816CCL | Recombinant Cynomolgus IFNAR1 cell lysate | +Inquiry |
IFNAR1-2372MCL | Recombinant Mouse IFNAR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNAR1 Products
Required fields are marked with *
My Review for All IFNAR1 Products
Required fields are marked with *