Recombinant Human IFNAR1 protein, His-tagged
Cat.No. : | IFNAR1-5633H |
Product Overview : | Recombinant Human IFNAR1 protein(376-557 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 376-557 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | NTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | IFNAR1 interferon (alpha, beta and omega) receptor 1 [ Homo sapiens ] |
Official Symbol | IFNAR1 |
Synonyms | IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC; CRF2-1; IFN-R-1; IFN-alpha/beta receptor 1; interferon-beta receptor 1; beta-type antiviral protein; alpha-type antiviral protein; type I interferon receptor 1; cytokine receptor class-II member 1; cytokine receptor family 2 member 1; interferon-alpha/beta receptor alpha chain; AVP; IFNBR; IFN-alpha-REC; |
Gene ID | 3454 |
mRNA Refseq | NM_000629 |
Protein Refseq | NP_000620 |
MIM | 107450 |
UniProt ID | P17181 |
◆ Recombinant Proteins | ||
IFNAR1-6422C | Recombinant Chicken IFNAR1 | +Inquiry |
IFNAR1-28344TH | Recombinant Human IFNAR1 | +Inquiry |
IFNAR1-78C | Recombinant Cynomolgus IFNAR1, Fc tagged | +Inquiry |
IFNAR1-80C | Recombinant Cynomolgus IFNAR1, LEVLFQ tagged | +Inquiry |
IFNAR1-4424H | Recombinant Human IFNAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNAR1-816CCL | Recombinant Cynomolgus IFNAR1 cell lysate | +Inquiry |
IFNAR1-2372MCL | Recombinant Mouse IFNAR1 cell lysate | +Inquiry |
IFNAR1-1643HCL | Recombinant Human IFNAR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNAR1 Products
Required fields are marked with *
My Review for All IFNAR1 Products
Required fields are marked with *