Recombinant Human IFNAR1 protein, His-tagged
| Cat.No. : | IFNAR1-5633H |
| Product Overview : | Recombinant Human IFNAR1 protein(376-557 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 376-557 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | NTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | IFNAR1 interferon (alpha, beta and omega) receptor 1 [ Homo sapiens ] |
| Official Symbol | IFNAR1 |
| Synonyms | IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC; CRF2-1; IFN-R-1; IFN-alpha/beta receptor 1; interferon-beta receptor 1; beta-type antiviral protein; alpha-type antiviral protein; type I interferon receptor 1; cytokine receptor class-II member 1; cytokine receptor family 2 member 1; interferon-alpha/beta receptor alpha chain; AVP; IFNBR; IFN-alpha-REC; |
| Gene ID | 3454 |
| mRNA Refseq | NM_000629 |
| Protein Refseq | NP_000620 |
| MIM | 107450 |
| UniProt ID | P17181 |
| ◆ Recombinant Proteins | ||
| IFNAR1-181H | Recombinant Human IFNAR1 protein, His-Avi-tagged | +Inquiry |
| Ifnar1-6940R | Recombinant Rat Ifnar1 protein, His-tagged | +Inquiry |
| IFNAR1-6938H | Recombinant Human IFNAR1 protein, His-tagged | +Inquiry |
| Ifnar1-3360M | Active Recombinant Mouse Ifnar1 protein, His-tagged | +Inquiry |
| IFNAR1-4424H | Recombinant Human IFNAR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNAR1-1643HCL | Recombinant Human IFNAR1 cell lysate | +Inquiry |
| IFNAR1-2372MCL | Recombinant Mouse IFNAR1 cell lysate | +Inquiry |
| IFNAR1-816CCL | Recombinant Cynomolgus IFNAR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNAR1 Products
Required fields are marked with *
My Review for All IFNAR1 Products
Required fields are marked with *



