Recombinant Human IFNB1 protein(22-187aa)
| Cat.No. : | IFNB1-4221H |
| Product Overview : | Recombinant Human IFNB1 protein(P01574)(22-187aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 22-187aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
| Gene Name | IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ] |
| Official Symbol | IFNB1 |
| Synonyms | IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956; |
| Gene ID | 3456 |
| mRNA Refseq | NM_002176 |
| Protein Refseq | NP_002167 |
| MIM | 147640 |
| UniProt ID | P01574 |
| ◆ Recombinant Proteins | ||
| IFNB1-241D | Active Recombinant Dog IFNB1 protein, His-GST-tagged | +Inquiry |
| Ifnb1-5168R | Recombinant Rat Ifnb1 protein | +Inquiry |
| Ifnb1-544M | Active Recombinant Mouse Ifnb1 | +Inquiry |
| Ifnb1-117M | Recombinant Active Mouse IFNB1 Protein, His-tagged(C-ter) | +Inquiry |
| Ifnb1-5167R | Recombinant Rat Ifnb1 protein, Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNB1-1117MCL | Recombinant Mouse IFNB1 cell lysate | +Inquiry |
| IFNB1-2931HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
| IFNB1-001HCL | Recombinant Human IFNB1 cell lysate | +Inquiry |
| IFNB1-889CCL | Recombinant Cynomolgus IFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNB1 Products
Required fields are marked with *
My Review for All IFNB1 Products
Required fields are marked with *
