Recombinant Human IFNB1 therapeutic protein(Interferon beta-1a)

Cat.No. : IFNB1-P018H
Product Overview : Human interferon beta (166 residues), glycosylated, MW=22.5kD. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Protein Length : 166 Aa
Description : It has been suggested that IFNB1 be merged into this article or section. The expression product is the active ingredient of Avonex, Belerofon and Rebif.
Molecular Mass : 20.5KDa
AA Sequence : MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFR QDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCA WTIVRVEILRNFYFINRLTGYLRN
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Alias : IFNB1; IFNB; IFB; IFF; IFN-beta; Interferon beta-1a
Gene Name IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ]
Official Symbol IFNB1
Synonyms IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956;
Gene ID 3456
mRNA Refseq NM_002176
Protein Refseq NP_002167
MIM 147640
UniProt ID P01574
Chromosome Location 9p22
Pathway Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem;
Function cytokine activity; interferon-alpha/beta receptor binding; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNB1 Products

Required fields are marked with *

My Review for All IFNB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon