Recombinant Human IFNE protein, GST-tagged

Cat.No. : IFNE-54H
Product Overview : Recombinant Human IFNE(109 a.a. - 208 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 109 a.a. - 208 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 Kda
AA Sequence : FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLT EKLSKQGRPLNDMKQELTTEFRSPR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name IFNE interferon, epsilon [ Homo sapiens ]
Official Symbol IFNE
Synonyms IFNE; interferon, epsilon; interferon epsilon; IFNE1; IFN-epsilon; interferon tau-1; interferon-epsilon; interferon epsilon 1; interferon epsilon-1; IFN-E; IFNT1; PRO655; MGC119018; MGC119020;
Gene ID 338376
mRNA Refseq NM_176891
Protein Refseq NP_795372
MIM 615223
UniProt ID Q86WN2
Chromosome Location 9p21.1
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem;
Function cytokine activity; cytokine receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNE Products

Required fields are marked with *

My Review for All IFNE Products

Required fields are marked with *

0
cart-icon