Recombinant Human IFNE protein, GST-tagged
| Cat.No. : | IFNE-54H |
| Product Overview : | Recombinant Human IFNE(109 a.a. - 208 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 109 a.a. - 208 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 Kda |
| AA Sequence : | FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLT EKLSKQGRPLNDMKQELTTEFRSPR |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | IFNE interferon, epsilon [ Homo sapiens ] |
| Official Symbol | IFNE |
| Synonyms | IFNE; interferon, epsilon; interferon epsilon; IFNE1; IFN-epsilon; interferon tau-1; interferon-epsilon; interferon epsilon 1; interferon epsilon-1; IFN-E; IFNT1; PRO655; MGC119018; MGC119020; |
| Gene ID | 338376 |
| mRNA Refseq | NM_176891 |
| Protein Refseq | NP_795372 |
| MIM | 615223 |
| UniProt ID | Q86WN2 |
| Chromosome Location | 9p21.1 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; RIG-I-like receptor signaling pathway, organism-specific biosystem; RIG-I-like receptor signaling pathway, conserved biosystem; |
| Function | cytokine activity; cytokine receptor binding; |
| ◆ Recombinant Proteins | ||
| IFNE-52H | Recombinant Human IFNE protein, His/T7-tagged | +Inquiry |
| IFNE-2272H | Recombinant Horse IFNE Protein, His-tagged | +Inquiry |
| IFNE-1688M | Recombinant Mouse IFNE Protein (22-192 aa), His-tagged | +Inquiry |
| IFNE-3697H | Recombinant Human IFNE Protein (Gln30-Arg208), N-His tagged | +Inquiry |
| IFNE-083H | Active Recombinant Human IFNE Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNE-5278HCL | Recombinant Human IFNE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNE Products
Required fields are marked with *
My Review for All IFNE Products
Required fields are marked with *
