Recombinant Human IFNG protein, hFc-Flag-tagged
| Cat.No. : | IFNG-8665H |
| Product Overview : | Recombinant Human IFNG protein(P01579)(24-166aa), fused with N-terminal hFc and Flag tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&Flag |
| Protein Length : | 24-166aa |
| Tag : | N-hFc-Flag |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Gene Name | IFNG interferon, gamma [ Homo sapiens ] |
| Official Symbol | IFNG |
| Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
| Gene ID | 3458 |
| mRNA Refseq | NM_000619 |
| Protein Refseq | NP_000610 |
| MIM | 147570 |
| UniProt ID | P01579 |
| ◆ Recombinant Proteins | ||
| IFNG-64E | Recombinant Equine Interferon, Gamma | +Inquiry |
| IFNG-473H | Active Recombinant Human IFNG, Met-tagged | +Inquiry |
| Ifng-01M | Active Recombinant Mouse Ifng Protein, His-Tagged | +Inquiry |
| Ifng-118R | Recombinant Rat IFNG Protein, Fc-His-tagged(C-ter) | +Inquiry |
| IFNG-440E | Recombinant Horse IFNG protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
| IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
| IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
| IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
