Recombinant Human IFNG protein, His-tagged
| Cat.No. : | IFNG-7655H |
| Product Overview : | Recombinant Human IFNG protein(22-166 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Tag : | His |
| Protein Length : | 22-166 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | YCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Gene Name | IFNG interferon, gamma [ Homo sapiens ] |
| Official Symbol | IFNG |
| Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
| Gene ID | 3458 |
| mRNA Refseq | NM_000619 |
| Protein Refseq | NP_000610 |
| MIM | 147570 |
| UniProt ID | P01579 |
| ◆ Recombinant Proteins | ||
| IFNG-801D | Recombinant Dog IFNG protein, His & T7-tagged | +Inquiry |
| Ifng-063M | Recombinant Mouse interferon gamma Protein, His&Flag tagged | +Inquiry |
| Ifng-7469R | Active Recombinant Rat Ifng protein, hFc-tagged | +Inquiry |
| IFNG-7656H | Recombinant Human IFNG protein, GST-tagged | +Inquiry |
| IFNG-1165C | Active Recombinant Cynomolgus IFNG Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
| IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
| IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
| IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *



