Recombinant Human IFNGR1 protein, His-Flag-tagged
| Cat.No. : | IFNGR1-7855H |
| Product Overview : | Recombinant Human IFNGR1 protein(P15260)(18-245aa), fused with C-terminal His and Flag tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Flag&His |
| Protein Length : | 18-245aa |
| Tag : | C-His-Flag |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.0 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG |
| Gene Name | IFNGR1 interferon gamma receptor 1 [ Homo sapiens ] |
| Official Symbol | IFNGR1 |
| Synonyms | IFNGR1; interferon gamma receptor 1; IFNGR; CD119; CDw119; AVP, type 2; IFN-gamma-R1; CD119 antigen; IFN-gamma receptor 1; antiviral protein, type 2; immune interferon receptor 1; interferon-gamma receptor alpha chain; FLJ45734; |
| Gene ID | 3459 |
| mRNA Refseq | NM_000416 |
| Protein Refseq | NP_000407 |
| MIM | 107470 |
| UniProt ID | P15260 |
| ◆ Recombinant Proteins | ||
| IFNGR1-105C | Recombinant Cynomolgus IFNGR1, His tagged | +Inquiry |
| IFNGR1-4425H | Recombinant Human IFNGR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ifngr1-6954M | Active Recombinant Mouse Ifngr1 protein(Met1-Asp253), His-tagged | +Inquiry |
| Ifngr1-5688M | Recombinant Mouse Ifngr1 Protein (Ala26-Asp253), C-His tagged | +Inquiry |
| IFNGR1-7671Z | Recombinant Zebrafish IFNGR1 | +Inquiry |
| ◆ Native Proteins | ||
| Ifngr1-43M | Active Recombinant Mouse Ifngr1 Homodimer Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
| IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
| IFNGR1-1775MCL | Recombinant Mouse IFNGR1 cell lysate | +Inquiry |
| IFNGR1-1175RCL | Recombinant Rat IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNGR1 Products
Required fields are marked with *
My Review for All IFNGR1 Products
Required fields are marked with *
