Recombinant Human IFNGR1 protein, His-Flag-tagged
Cat.No. : | IFNGR1-7855H |
Product Overview : | Recombinant Human IFNGR1 protein(P15260)(18-245aa), fused with C-terminal His and Flag tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag&His |
Protein Length : | 18-245aa |
Tag : | C-His-Flag |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG |
Gene Name | IFNGR1 interferon gamma receptor 1 [ Homo sapiens ] |
Official Symbol | IFNGR1 |
Synonyms | IFNGR1; interferon gamma receptor 1; IFNGR; CD119; CDw119; AVP, type 2; IFN-gamma-R1; CD119 antigen; IFN-gamma receptor 1; antiviral protein, type 2; immune interferon receptor 1; interferon-gamma receptor alpha chain; FLJ45734; |
Gene ID | 3459 |
mRNA Refseq | NM_000416 |
Protein Refseq | NP_000407 |
MIM | 107470 |
UniProt ID | P15260 |
◆ Recombinant Proteins | ||
IFNGR1-1207C | Active Recombinant Cynomolgus IFNGR1 Protein, Fc-tagged | +Inquiry |
IFNGR1-116H | Recombinant Human IFNGR1 protein | +Inquiry |
IFNGR1-2208R | Recombinant Rhesus monkey IFNGR1 Protein, His-tagged | +Inquiry |
IFNGR1-105C | Recombinant Cynomolgus IFNGR1, His tagged | +Inquiry |
IFNGR1-001H | Recombinant Human IFNGR1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IFNGR1-71H | Active Recombinant Human IFNGR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
IFNGR1-1175RCL | Recombinant Rat IFNGR1 cell lysate | +Inquiry |
IFNGR1-1775MCL | Recombinant Mouse IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNGR1 Products
Required fields are marked with *
My Review for All IFNGR1 Products
Required fields are marked with *
0
Inquiry Basket