Recombinant Human IFNGR2 protein, His-tagged
| Cat.No. : | IFNGR2-20H |
| Product Overview : | Recombinant Human IFNGR2 protein(125-324 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 125-324 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIIS |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) [ Homo sapiens ] |
| Official Symbol | IFNGR2 |
| Synonyms | AF-1; IFGR2; IFNGT1; IMD28 |
| Gene ID | 3460 |
| mRNA Refseq | NM_005534 |
| Protein Refseq | NP_005525 |
| MIM | 147569 |
| UniProt ID | P38484 |
| ◆ Recombinant Proteins | ||
| IFNGR2-1083H | Recombinant Human IFNGR2 Protein, MYC/DDK-tagged | +Inquiry |
| IFNGR2-1152H | Recombinant Human IFNGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IFNGR2-265I | Active Recombinant Human IFNGR2 Protein | +Inquiry |
| IFNGR2-241H | Recombinant Human IFNGR2 | +Inquiry |
| Ifngr2-4445M | Recombinant Mouse Ifngr2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNGR2-1899MCL | Recombinant Mouse IFNGR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNGR2 Products
Required fields are marked with *
My Review for All IFNGR2 Products
Required fields are marked with *



