"IFNL1" Related Products

Expand

Recombinant Human IFNL1 Protein

Cat.No.: IFNL1-945H
Product Overview: Recombinant Human IFNL1 was expressed in E. coli.
Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Source: E. coli
Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Bio-activity: Determined by its ability to activate STAT phosphorylation in an ISRE Luciferase Reporter Assay using human colon carcinoma COLO205 cells. The expected ED50 is 0.2-0.5 ng/ml.
Molecular Mass: 19.8 kDa
AA Sequence: PTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPES
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration: Resuspend the protein in the desired concentration in proper buffer
Gene Name: IFNL1 interferon lambda 1 [ Homo sapiens (human) ]
Official Symbol: IFNL1
Synonyms: L29; IL-29
Gene ID: 282618
mRNA Refseq: NM_172140
Protein Refseq: NP_742152
MIM: 607403
UniProt ID: Q8IU54

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.