Recombinant Human IFNL1 Protein, His-tagged
| Cat.No. : | IFNL1-01H |
| Product Overview : | Recombinant human IFNL1 (20-200aa, 187aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 20-200 a.a. |
| Description : | This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). |
| Form : | Liquid |
| Molecular Mass : | 20.8 kDa |
| AA Sequence : | GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHH |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | IFNL1 interferon lambda 1 [ Homo sapiens (human) ] |
| Official Symbol | IFNL1 |
| Synonyms | IFNL1; interferon lambda 1; IL29; IL-29; interferon lambda-1; IFN-lambda-1; cytokine Zcyto21; interleukin 29 (interferon, lambda 1); interleukin-29 |
| Gene ID | 282618 |
| mRNA Refseq | NM_172140 |
| Protein Refseq | NP_742152 |
| MIM | 607403 |
| UniProt ID | Q8IU54 |
| ◆ Recombinant Proteins | ||
| IFNL1-299H | Recombinant Human IFNL1, StrepII-tagged | +Inquiry |
| Ifnl1-2771R | Recombinant Rat Ifnl1 Protein, His-tagged | +Inquiry |
| IFNL1-3816H | Recombinant Human IFNL1 Protein (Met1-Thr200), C-His tagged | +Inquiry |
| IFNL1-01H | Recombinant Human IFNL1 Protein, His-tagged | +Inquiry |
| IFNL1-02H | Active Recombinant Human IFNL1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNL1-2007HCL | Recombinant Human IFNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNL1 Products
Required fields are marked with *
My Review for All IFNL1 Products
Required fields are marked with *
