Recombinant Human IFNL1 Protein, His-tagged
Cat.No. : | IFNL1-01H |
Product Overview : | Recombinant human IFNL1 (20-200aa, 187aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | August 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 20-200 a.a. |
Description : | This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). |
Form : | Liquid |
Molecular Mass : | 20.8 kDa |
AA Sequence : | GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPESTHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | IFNL1 interferon lambda 1 [ Homo sapiens (human) ] |
Official Symbol | IFNL1 |
Synonyms | IFNL1; interferon lambda 1; IL29; IL-29; interferon lambda-1; IFN-lambda-1; cytokine Zcyto21; interleukin 29 (interferon, lambda 1); interleukin-29 |
Gene ID | 282618 |
mRNA Refseq | NM_172140 |
Protein Refseq | NP_742152 |
MIM | 607403 |
UniProt ID | Q8IU54 |
◆ Recombinant Proteins | ||
IFNL1-3689H | Recombinant Human IFNL1 Protein (Gly20-Thr200), His tagged | +Inquiry |
IFNL1-120H | Recombinant Active Human IFNL1 Protein, His-tagged(C-ter) | +Inquiry |
IFNL1-01H | Recombinant Human IFNL1 Protein, His-tagged | +Inquiry |
IFNL1-118H | Recombinant Human IFNL1 Protein | +Inquiry |
IFNL1-17H | Active Recombinant Human IFNL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNL1-2007HCL | Recombinant Human IFNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNL1 Products
Required fields are marked with *
My Review for All IFNL1 Products
Required fields are marked with *