Recombinant Human IgA protein, GST-tagged
| Cat.No. : | IgA-301128H |
| Product Overview : | Recombinant Human IgA (4-353 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Thr4-Tyr353 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | TSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | Iimmunoglobulin heavy constant alpha 1 [ Homo sapiens ] |
| Official Symbol | IgA |
| ◆ Recombinant Proteins | ||
| IgA-3446H | Recombinant Human IgA protein, His-tagged | +Inquiry |
| IgA-2273P | Recombinant Pig IgA Protein, His-tagged | +Inquiry |
| IgA-301128H | Recombinant Human IgA protein, GST-tagged | +Inquiry |
| iga-573S | Recombinant Streptococcus pneumoniae iga protein, His-tagged | +Inquiry |
| IgA-15B | Recombinant Bovine IgA Protein, His tagged | +Inquiry |
| ◆ Native Proteins | ||
| IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
| IgA-252H | Native Human Immunoglobulin A | +Inquiry |
| IgA-239S | Native Sheep Immunoglobulin A | +Inquiry |
| IgA-7431M | Native Mouse Immunoglobulin A | +Inquiry |
| IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IgA Products
Required fields are marked with *
My Review for All IgA Products
Required fields are marked with *
