Recombinant Human IGDCC4 Protein, GST-tagged
Cat.No. : | IGDCC4-5988H |
Product Overview : | Human NOPE partial ORF ( NP_066013, 1152 a.a. - 1250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | IGDCC4 (Immunoglobulin Superfamily DCC Subclass Member 4) is a Protein Coding gene. An important paralog of this gene is PRTG. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | DLEPEDPLPPEAPDLISGVGDPGQGAAWLDRELGGCELAAPGPDRLTCLPEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IGDCC4 immunoglobulin superfamily, DCC subclass, member 4 [ Homo sapiens ] |
Official Symbol | IGDCC4 |
Synonyms | IGDCC4; immunoglobulin superfamily, DCC subclass, member 4; immunoglobulin superfamily DCC subclass member 4; likely ortholog of mouse neighbor of Punc E11; LOC57722; NOPE; hDDM36; neighbor of Punc E11; DDM36; FLJ42051; KIAA1628; |
Gene ID | 57722 |
mRNA Refseq | NM_020962 |
Protein Refseq | NP_066013 |
UniProt ID | Q8TDY8 |
◆ Recombinant Proteins | ||
IGDCC4-8062M | Recombinant Mouse IGDCC4 Protein | +Inquiry |
IGDCC4-4459M | Recombinant Mouse IGDCC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGDCC4-5988H | Recombinant Human IGDCC4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGDCC4 Products
Required fields are marked with *
My Review for All IGDCC4 Products
Required fields are marked with *