Recombinant Human IGF1 protein
Cat.No. : | IGF1-524H |
Product Overview : | Recombinant Human IGF1 protein (67 a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 67 |
Description : | IGF-1 belonged to the insulin gene family, is a mitogenic polypeptide growth factor that stimulates the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. DES(1-3)IGF-1, is a truncated variant of human IGF-1 with the tripeptide Gly-Pro-Glu absent from the N-terminus. It has been isolated from bovine colostrum, human brain and porcine uterus. The DES(1-3)IGF-1 probably results from post-translational cleavage of IGF-1. It has about 10-fold more potent than IGF-1 at stimulating hypertrophy and proliferation of cultured cells, a consequence of much reduced binding to IGF-binding proteins, in turn caused by the absence of the glutamate at position 3. Clinical opportunities for DES(1-3)IGF-1 have not yet been evaluated, but could apply in catabolic states as well as for the treatment of inflammatory bowel diseases. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 7.4 kDa, a single non-glycosylated polypeptide chain containing 67 amino acids. |
AA Sequence : | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Endotoxin : | Less than 50 EU/mg of rHuDES1-3 IGF-1 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IGF1 |
Official Symbol | IGF1 |
Synonyms | IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I; |
Gene ID | 3479 |
mRNA Refseq | NM_000618 |
Protein Refseq | NP_000609 |
MIM | 147440 |
UniProt ID | P05019 |
◆ Recombinant Proteins | ||
Igf1-079M | Active Recombinant Mouse Igf1 Protein | +Inquiry |
IGF1-809C | Recombinant Chicken IGF1 protein, His & GST-tagged | +Inquiry |
IGF1-4460M | Recombinant Mouse IGF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGF1-126H | Recombinant Active Human IGF1 Protein, Fc-His-tagged(C-ter) | +Inquiry |
IGF1-0243H | Active Recombinant Human IGF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *
0
Inquiry Basket