Recombinant Human IGF1 protein

Cat.No. : IGF1-524H
Product Overview : Recombinant Human IGF1 protein (67 a.a.) was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 67
Description : IGF-1 belonged to the insulin gene family, is a mitogenic polypeptide growth factor that stimulates the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. DES(1-3)IGF-1, is a truncated variant of human IGF-1 with the tripeptide Gly-Pro-Glu absent from the N-terminus. It has been isolated from bovine colostrum, human brain and porcine uterus. The DES(1-3)IGF-1 probably results from post-translational cleavage of IGF-1. It has about 10-fold more potent than IGF-1 at stimulating hypertrophy and proliferation of cultured cells, a consequence of much reduced binding to IGF-binding proteins, in turn caused by the absence of the glutamate at position 3. Clinical opportunities for DES(1-3)IGF-1 have not yet been evaluated, but could apply in catabolic states as well as for the treatment of inflammatory bowel diseases.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 7.4 kDa, a single non-glycosylated polypeptide chain containing 67 amino acids.
AA Sequence : TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Endotoxin : Less than 50 EU/mg of rHuDES1-3 IGF-1 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IGF1
Official Symbol IGF1
Synonyms IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I;
Gene ID 3479
mRNA Refseq NM_000618
Protein Refseq NP_000609
MIM 147440
UniProt ID P05019

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGF1 Products

Required fields are marked with *

My Review for All IGF1 Products

Required fields are marked with *

0
cart-icon