| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
67 |
| Description : |
IGF-1 belonged to the insulin gene family, is a mitogenic polypeptide growth factor that stimulates the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. DES(1-3)IGF-1, is a truncated variant of human IGF-1 with the tripeptide Gly-Pro-Glu absent from the N-terminus. It has been isolated from bovine colostrum, human brain and porcine uterus. The DES(1-3)IGF-1 probably results from post-translational cleavage of IGF-1. It has about 10-fold more potent than IGF-1 at stimulating hypertrophy and proliferation of cultured cells, a consequence of much reduced binding to IGF-binding proteins, in turn caused by the absence of the glutamate at position 3. Clinical opportunities for DES(1-3)IGF-1 have not yet been evaluated, but could apply in catabolic states as well as for the treatment of inflammatory bowel diseases. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
| Molecular Mass : |
Approximately 7.4 kDa, a single non-glycosylated polypeptide chain containing 67 amino acids. |
| AA Sequence : |
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Endotoxin : |
Less than 50 EU/mg of rHuDES1-3 IGF-1 as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |