Recombinant Human IGF1 protein

Cat.No. : IGF1-3928H
Product Overview : Recombinant Human IGF1 protein (15N Stable Isotope Labeled) was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 70
Description : The insulin-like growth factors (IGFs) belonged to the insulin gene family, are mitogenic polypeptide growth factors that stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. The IGFs are similar by structure and function to insulin, but have a much higher growth-promoting activity than insulin. IGF-1 is produced primarily by the liver as an endocrine hormone as well as in target tissues in a paracrine/autocrine fashion. The production of IGF-1 is stimulated by growth hormone (GH) and can be retarded by undernutrition, growth hormone insensitivity, lack of growth hormone receptors, or failures of the downstream signaling pathway post GH receptor including SHP2 and STAT5B. Recombinant human IGF-1 are globular proteins containing 70 amino acids and 3 intra-molecular disulfide bonds. Mature human IGF-1 shares 94 % and 96 % a.a. sequence identity with mouse and rat IGF-1, respectively, and exhibits cross-species activity.
Form : Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.2.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 7743 Da, a single non-glycosylated polypeptide chain containing 70 amino acids. 15N stable isotope labeled.
AA Sequence : GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Endotoxin : Less than 1 EU/μg of rHuIGF-1, 15N as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IGF1
Official Symbol IGF1
Synonyms IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I;
Gene ID 3479
mRNA Refseq NM_000618
Protein Refseq NP_000609
MIM 147440
UniProt ID P05019

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGF1 Products

Required fields are marked with *

My Review for All IGF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon