Recombinant Human IGF1 protein, GST-tagged
Cat.No. : | IGF1-4121H |
Product Overview : | Recombinant Human IGF1 protein(P05019)(49-118aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 49-118aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.7 kDa |
AA Sequence : | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ] |
Official Symbol | IGF1 |
Synonyms | IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I; |
Gene ID | 3479 |
mRNA Refseq | NM_000618 |
Protein Refseq | NP_000609 |
MIM | 147440 |
UniProt ID | P05019 |
◆ Recombinant Proteins | ||
IGF1-21H | Active Recombinant Human IGF1 Protein, Pre-aliquoted | +Inquiry |
Igf1-812M | Recombinant Mouse Igf1 protein, His & T7-tagged | +Inquiry |
IGF1-06H | Recombinant Human IGF1 protein | +Inquiry |
IGF1-119H | Active Recombinant Human IGF1 Protein | +Inquiry |
IGF1-558H | Recombinant Human IGF1 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *