Recombinant Human IGF1 therapeutic protein(Mecasermin)
| Cat.No. : | IGF1-P059H |
| Product Overview : | IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human?IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human?IGF-1. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 70 Aa |
| Description : | IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1. |
| Molecular Mass : | 76.5 Kda |
| AA Sequence : | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Endotoxin : | < 1.0 EU per μg of the protein |
| Purity : | >95% |
| Unit Definition : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
| Alias : | IGF1; IGF1A; MGF; IGF-IA; IGF-IB; IGFI; IGF-I; Mecasermin |
| Gene Name | IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ] |
| Official Symbol | IGF1 |
| Synonyms | IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I; |
| Gene ID | 3479 |
| mRNA Refseq | NM_000618 |
| Protein Refseq | NP_000609 |
| MIM | 147440 |
| UniProt ID | P05019 |
| Chromosome Location | 12q23.2 |
| Pathway | Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dilated cardiomyopathy, organism-specific biosystem; |
| Function | growth factor activity; hormone activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; integrin binding; protein binding; |
| ◆ Recombinant Proteins | ||
| IGF1-3928H | Recombinant Human IGF1 protein, 15N Stable Isotope Labeled | +Inquiry |
| IGF1-2215R | Recombinant Rhesus monkey IGF1 Protein, His-tagged | +Inquiry |
| Igf1-080M | Active Recombinant Mouse Igf1 Protein | +Inquiry |
| IGF1-21H | Active Recombinant Human IGF1 Protein, Pre-aliquoted | +Inquiry |
| IGF1-527H | Recombinant Human IGF1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGF1-5268HCL | Recombinant Human IGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1 Products
Required fields are marked with *
My Review for All IGF1 Products
Required fields are marked with *
