Recombinant Human IGF1 therapeutic protein(Mecasermin)

Cat.No. : IGF1-P059H
Product Overview : IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human?IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human?IGF-1.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 70 Aa
Description : IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1.
Molecular Mass : 76.5 Kda
AA Sequence : GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Unit Definition : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Alias : IGF1; IGF1A; MGF; IGF-IA; IGF-IB; IGFI; IGF-I; Mecasermin
Gene Name IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ]
Official Symbol IGF1
Synonyms IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I;
Gene ID 3479
mRNA Refseq NM_000618
Protein Refseq NP_000609
MIM 147440
UniProt ID P05019
Chromosome Location 12q23.2
Pathway Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Dilated cardiomyopathy, organism-specific biosystem;
Function growth factor activity; hormone activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; integrin binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGF1 Products

Required fields are marked with *

My Review for All IGF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon