Expand
Expand
| Cat.No.: | IGF2BP1-526H |
| Product Overview: | Recombinant Human IGF2BP1(1 a.a. - 577 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
| Description: | This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene. |
| Source: | Wheat Germ |
| Species: | Human |
| Tag: | GST |
| Form: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass: | 89.87 kDa |
| AA Sequence: | MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVP KKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALK VSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQT QSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGL FPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSK VRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPR DQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK |
| Applications: | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes: | Best use within three months from the date of receipt of this protein. |
| Storage: | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name: | IGF2BP1 insulin-like growth factor 2 mRNA binding protein 1 [ Homo sapiens ] |
| Official Symbol: | IGF2BP1 |
| Synonyms: | IGF2BP1; insulin-like growth factor 2 mRNA binding protein 1; insulin-like growth factor 2 mRNA-binding protein 1; IGF II mRNA binding protein 1; IMP 1; ZBP-1; VICKZ family member 1; zipcode-binding protein 1; IGF2 mRNA-binding protein 1; IGF-II mRNA-binding protein 1; coding region determinant-binding protein; IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1; |
| Gene ID: | 10642 |
| mRNA Refseq: | NM_001160423 |
| Protein Refseq: | NP_001153895 |
| MIM: | 608288 |
| UniProt ID: | Q9NZI8 |
| Chromosome Location: | 17q21.32 |
| Pathway: | Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs), organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
| Function: | mRNA 3-UTR binding; mRNA 5-UTR binding; mRNA binding; nucleotide binding; protein binding; translation regulator activity; |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All IGF2BP1 Products
Download Datasheet