"IGF2BP1" Related Products

Expand
Expand
Expand

Recombinant Human IGF2BP1 protein, GST-tagged

Cat.No.: IGF2BP1-526H
Product Overview: Recombinant Human IGF2BP1(1 a.a. - 577 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 89.87 kDa
AA Sequence: MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVP KKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALK VSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQT QSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGL FPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSK VRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPR DQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: IGF2BP1 insulin-like growth factor 2 mRNA binding protein 1 [ Homo sapiens ]
Official Symbol: IGF2BP1
Synonyms: IGF2BP1; insulin-like growth factor 2 mRNA binding protein 1; insulin-like growth factor 2 mRNA-binding protein 1; IGF II mRNA binding protein 1; IMP 1; ZBP-1; VICKZ family member 1; zipcode-binding protein 1; IGF2 mRNA-binding protein 1; IGF-II mRNA-binding protein 1; coding region determinant-binding protein; IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1;
Gene ID: 10642
mRNA Refseq: NM_001160423
Protein Refseq: NP_001153895
MIM: 608288
UniProt ID: Q9NZI8
Chromosome Location: 17q21.32
Pathway: Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs), organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function: mRNA 3-UTR binding; mRNA 5-UTR binding; mRNA binding; nucleotide binding; protein binding; translation regulator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.