Recombinant Human IGF2BP1 protein, GST-tagged
Cat.No. : | IGF2BP1-526H |
Product Overview : | Recombinant Human IGF2BP1(1 a.a. - 577 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-577 a.a. |
Description : | This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 89.87 kDa |
AA Sequence : | MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVP KKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALK VSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQT QSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGL FPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSK VRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPR DQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | IGF2BP1 insulin-like growth factor 2 mRNA binding protein 1 [ Homo sapiens ] |
Official Symbol | IGF2BP1 |
Synonyms | IGF2BP1; insulin-like growth factor 2 mRNA binding protein 1; insulin-like growth factor 2 mRNA-binding protein 1; IGF II mRNA binding protein 1; IMP 1; ZBP-1; VICKZ family member 1; zipcode-binding protein 1; IGF2 mRNA-binding protein 1; IGF-II mRNA-binding protein 1; coding region determinant-binding protein; IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1; |
Gene ID | 10642 |
mRNA Refseq | NM_001160423 |
Protein Refseq | NP_001153895 |
MIM | 608288 |
UniProt ID | Q9NZI8 |
Chromosome Location | 17q21.32 |
Pathway | Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs), organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
Function | mRNA 3-UTR binding; mRNA 5-UTR binding; mRNA binding; nucleotide binding; protein binding; translation regulator activity; |
◆ Recombinant Proteins | ||
IGF2BP1-3491H | Recombinant Human IGF2BP1 protein, His-tagged | +Inquiry |
IGF2BP1-01H | Recombinant Human IGF2BP1 Protein, His-tagged | +Inquiry |
IGF2BP1-2038R | Recombinant Rhesus Macaque IGF2BP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGF2BP1-4160H | Recombinant Human IGF2BP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IGF2BP1-4462M | Recombinant Mouse IGF2BP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2BP1-5265HCL | Recombinant Human IGF2BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2BP1 Products
Required fields are marked with *
My Review for All IGF2BP1 Products
Required fields are marked with *