Recombinant Human IGF2BP1 protein, His-tagged
Cat.No. : | IGF2BP1-3491H |
Product Overview : | Recombinant Human IGF2BP1 protein(126-198 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 126-198 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IGF2BP1 insulin-like growth factor 2 mRNA binding protein 1 [ Homo sapiens ] |
Official Symbol | IGF2BP1 |
Synonyms | IGF2BP1; insulin-like growth factor 2 mRNA binding protein 1; insulin-like growth factor 2 mRNA-binding protein 1; IGF II mRNA binding protein 1; IMP 1; ZBP-1; VICKZ family member 1; zipcode-binding protein 1; IGF2 mRNA-binding protein 1; IGF-II mRNA-binding protein 1; coding region determinant-binding protein; IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1; |
Gene ID | 10642 |
mRNA Refseq | NM_001160423 |
Protein Refseq | NP_001153895 |
MIM | 608288 |
UniProt ID | Q9NZI8 |
◆ Recombinant Proteins | ||
IGF2BP1-3991H | Recombinant Human IGF2BP1 protein(1-577aa), His&Myc-tagged | +Inquiry |
IGF2BP1-4568HFL | Recombinant Full Length Human IGF2BP1, Flag-tagged | +Inquiry |
IGF2BP1-2038R | Recombinant Rhesus Macaque IGF2BP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGF2BP1-5321H | Recombinant Human IGF2BP1 protein, His-tagged | +Inquiry |
Igf2bp1-987M | Recombinant Mouse Igf2bp1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2BP1-5265HCL | Recombinant Human IGF2BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGF2BP1 Products
Required fields are marked with *
My Review for All IGF2BP1 Products
Required fields are marked with *
0
Inquiry Basket