Recombinant Human IGF2BP1 protein, His-tagged

• Cat.No.: IGF2BP1-3491H
• Product Overview: Recombinant Human IGF2BP1 protein(126-198 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 126-198 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IGF2BP1 insulin-like growth factor 2 mRNA binding protein 1 [ Homo sapiens ]
• Official Symbol: IGF2BP1
• Synonyms: IGF2BP1; insulin-like growth factor 2 mRNA binding protein 1; insulin-like growth factor 2 mRNA-binding protein 1; IGF II mRNA binding protein 1; IMP 1; ZBP-1; VICKZ family member 1; zipcode-binding protein 1; IGF2 mRNA-binding protein 1; IGF-II mRNA-binding protein 1; coding region determinant-binding protein; IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1
• Gene ID: 10642
• mRNA Refseq: NM_001160423
• Protein Refseq: NP_001153895
• MIM: 608288
• UniProt ID: Q9NZI8