Recombinant Human IGF2BP3 protein, His-tagged
| Cat.No. : | IGF2BP3-3360H |
| Product Overview : | Recombinant Human IGF2BP3 protein(240-579 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 240-579 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IGF2BP3 insulin-like growth factor 2 mRNA binding protein 3 [ Homo sapiens ] |
| Official Symbol | IGF2BP3 |
| Synonyms | IGF2BP3; insulin-like growth factor 2 mRNA binding protein 3; insulin-like growth factor 2 mRNA-binding protein 3; cancer/testis antigen 98; CT98; IGF II mRNA binding protein 3; IMP 3; hKOC; VICKZ family member 3; IGF2 mRNA-binding protein 3; IGF-II mRNA-binding protein 3; KH domain containing protein overexpressed in cancer; KH domain-containing protein overexpressed in cancer; IMP3; KOC1; IMP-3; VICKZ3; DKFZp686F1078; |
| Gene ID | 10643 |
| mRNA Refseq | NM_006547 |
| Protein Refseq | NP_006538 |
| MIM | 608259 |
| UniProt ID | O00425 |
| ◆ Recombinant Proteins | ||
| IGF2BP3-5147H | Recombinant Human IGF2BP3 Protein, GST-tagged | +Inquiry |
| IGF2BP3-8068M | Recombinant Mouse IGF2BP3 Protein | +Inquiry |
| IGF2BP3-4464M | Recombinant Mouse IGF2BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IGF2BP3-14103H | Recombinant Human IGF2BP3 protein, GST-tagged | +Inquiry |
| IGF2BP3-3360H | Recombinant Human IGF2BP3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2BP3 Products
Required fields are marked with *
My Review for All IGF2BP3 Products
Required fields are marked with *
