Recombinant Human IGF2R protein, His-Myc-tagged

• Cat.No.: IGF2R-674H
• Product Overview: Recombinant Human IGF2R protein(P11717)(628-772aa), fused with C-terminal His and Myc tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His&Myc
• Protein Length: 628-772aa
• Tag: C-His-Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 20.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP

Gene Information

• Gene Name: IGF2R insulin-like growth factor 2 receptor [ Homo sapiens ]
• Official Symbol: IGF2R
• Synonyms: IGF2R; insulin-like growth factor 2 receptor; cation-independent mannose-6-phosphate receptor; cation independent mannose 6 phosphate receptor; CD222; CIMPR; M6P R; MPR1; MPRI; M6PR; CI-MPR; MPR 300; M6P/IGF2R; IGF-II receptor; M6P/IGF2 receptor; CI Man-6-P receptor; 300 kDa mannose 6-phosphate receptor; insulin-like growth factor II receptor; cation-independent mannose-6 phosphate receptor; M6P-R
• Gene ID: 3482
• mRNA Refseq: NM_000876
• Protein Refseq: NP_000867
• MIM: 147280
• UniProt ID: P11717