Recombinant Human IGF2R protein, His-Myc-tagged

Cat.No. : IGF2R-674H
Product Overview : Recombinant Human IGF2R protein(P11717)(628-772aa), fused with C-terminal His and Myc tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His&Myc
Protein Length : 628-772aa
Tag : C-His-Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.7 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Gene Name IGF2R insulin-like growth factor 2 receptor [ Homo sapiens ]
Official Symbol IGF2R
Synonyms IGF2R; insulin-like growth factor 2 receptor; cation-independent mannose-6-phosphate receptor; cation independent mannose 6 phosphate receptor; CD222; CIMPR; M6P R; MPR1; MPRI; M6PR; CI-MPR; MPR 300; M6P/IGF2R; IGF-II receptor; M6P/IGF2 receptor; CI Man-6-P receptor; 300 kDa mannose 6-phosphate receptor; insulin-like growth factor II receptor; cation-independent mannose-6 phosphate receptor; M6P-R;
Gene ID 3482
mRNA Refseq NM_000876
Protein Refseq NP_000867
MIM 147280
UniProt ID P11717

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGF2R Products

Required fields are marked with *

My Review for All IGF2R Products

Required fields are marked with *

0
cart-icon
0
compare icon