Recombinant Human IGF2R protein, His-Myc-tagged
Cat.No. : | IGF2R-674H |
Product Overview : | Recombinant Human IGF2R protein(P11717)(628-772aa), fused with C-terminal His and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 628-772aa |
Tag : | C-His-Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP |
Gene Name | IGF2R insulin-like growth factor 2 receptor [ Homo sapiens ] |
Official Symbol | IGF2R |
Synonyms | IGF2R; insulin-like growth factor 2 receptor; cation-independent mannose-6-phosphate receptor; cation independent mannose 6 phosphate receptor; CD222; CIMPR; M6P R; MPR1; MPRI; M6PR; CI-MPR; MPR 300; M6P/IGF2R; IGF-II receptor; M6P/IGF2 receptor; CI Man-6-P receptor; 300 kDa mannose 6-phosphate receptor; insulin-like growth factor II receptor; cation-independent mannose-6 phosphate receptor; M6P-R; |
Gene ID | 3482 |
mRNA Refseq | NM_000876 |
Protein Refseq | NP_000867 |
MIM | 147280 |
UniProt ID | P11717 |
◆ Recombinant Proteins | ||
Igf2r-849M | Recombinant Mouse Igf2r protein, His-tagged | +Inquiry |
IGF2R-2323B | Recombinant Bovine IGF2R protein, hFc-tagged | +Inquiry |
IGF2R-341H | Recombinant Human IGF2R protein, His-Avi-tagged | +Inquiry |
IGF2R-2639H | Recombinant Human IGF2R protein(501-580 aa), C-His-tagged | +Inquiry |
IGF2R-626H | Active Recombinant Human IGF2R, Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2R Products
Required fields are marked with *
My Review for All IGF2R Products
Required fields are marked with *