Recombinant Human IGFBP1 protein, GST-tagged

Cat.No. : IGFBP1-7434H
Product Overview : Recombinant Human IGFBP1 protein(81-259 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 81-259 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSIPWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name IGFBP1 insulin-like growth factor binding protein 1 [ Homo sapiens ]
Official Symbol IGFBP1
Synonyms IGFBP1; insulin-like growth factor binding protein 1; IBP1; insulin-like growth factor-binding protein 1; AFBP; alpha pregnancy associated endometrial globulin; amniotic fluid binding protein; binding protein 25; binding protein 26; binding protein 28; growth hormone independent binding protein; hIGFBP 1; IGF binding protein 1; IGF BP25; placental protein 12; PP12; IBP-1; IGFBP-1; binding protein-25; binding protein-26; binding protein-28; IGF-binding protein 1; growth hormone independent-binding protein; alpha-pregnancy-associated endometrial globulin; IGF-BP25; hIGFBP-1;
Gene ID 3484
mRNA Refseq NM_000596
Protein Refseq NP_000587
MIM 146730
UniProt ID P08833

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFBP1 Products

Required fields are marked with *

My Review for All IGFBP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon