Recombinant Human IGFBP1 protein, GST-tagged
Cat.No. : | IGFBP1-7434H |
Product Overview : | Recombinant Human IGFBP1 protein(81-259 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 81-259 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSIPWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | IGFBP1 insulin-like growth factor binding protein 1 [ Homo sapiens ] |
Official Symbol | IGFBP1 |
Synonyms | IGFBP1; insulin-like growth factor binding protein 1; IBP1; insulin-like growth factor-binding protein 1; AFBP; alpha pregnancy associated endometrial globulin; amniotic fluid binding protein; binding protein 25; binding protein 26; binding protein 28; growth hormone independent binding protein; hIGFBP 1; IGF binding protein 1; IGF BP25; placental protein 12; PP12; IBP-1; IGFBP-1; binding protein-25; binding protein-26; binding protein-28; IGF-binding protein 1; growth hormone independent-binding protein; alpha-pregnancy-associated endometrial globulin; IGF-BP25; hIGFBP-1; |
Gene ID | 3484 |
mRNA Refseq | NM_000596 |
Protein Refseq | NP_000587 |
MIM | 146730 |
UniProt ID | P08833 |
◆ Recombinant Proteins | ||
IGFBP1-143H | Active Recombinant Human IGFBP1 Protein | +Inquiry |
IGFBP1-1249H | Active Recombinant Human IGFBP1 protein, His-tagged | +Inquiry |
IGFBP1-823P | Recombinant Pig IGFBP1 protein, His & T7-tagged | +Inquiry |
IGFBP1-3007R | Recombinant Rat IGFBP1 Protein | +Inquiry |
IGFBP1-1189R | Active Recombinant Rhesus IGFBP1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP1-1482CCL | Recombinant Cynomolgus IGFBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFBP1 Products
Required fields are marked with *
My Review for All IGFBP1 Products
Required fields are marked with *