Recombinant Human IGFBP3 protein(121-200 aa), C-His-tagged

Cat.No. : IGFBP3-2678H
Product Overview : Recombinant Human IGFBP3 protein(P17936)(121-200 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 121-200 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 11 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNF
Gene Name IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ]
Official Symbol IGFBP3
Synonyms IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding protein 3; IBP-3; IGFBP-3; IGF-binding protein 3; growth hormone-dependent binding protein; BP-53;
Gene ID 3486
mRNA Refseq NM_000598
Protein Refseq NP_000589
MIM 146732
UniProt ID P17936

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFBP3 Products

Required fields are marked with *

My Review for All IGFBP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon