Recombinant Human IGFBP4 protein, T7/His-tagged

Cat.No. : IGFBP4-60H
Product Overview : Recombinant human IGFBP4 cDNA (22-258aa, derived from BC016041) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 22-258 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPC GVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKH FAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHP ALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro IGFBP4 mediated VEGF pathway regulation study on endothelial cell growth with this protein as either coating matrix protein or as soluble factor.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name IGFBP4 insulin-like growth factor binding protein 4 [ Homo sapiens ]
Official Symbol IGFBP4
Synonyms IGFBP4; insulin-like growth factor binding protein 4; insulin like growth factor binding protein 4; insulin-like growth factor-binding protein 4; BP 4; HT29 IGFBP; IBP4; IGF binding protein 4; IGFBP 4; IBP-4; IGF-binding protein 4; BP-4; IGFBP-4; HT29-IGF
Gene ID 3487
mRNA Refseq NM_001552
Protein Refseq NP_001543
MIM 146733
UniProt ID P22692
Chromosome Location 17q12-q21.1
Pathway Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; Wnt signaling network, organism-specific biosystem;
Function insulin-like growth factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFBP4 Products

Required fields are marked with *

My Review for All IGFBP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon