Recombinant Human IGFBP7 protein, His-tagged

• Cat.No.: IGFBP7-533H
• Product Overview: Recombinant Human IGFBP7 protein(Q16270)(27-282aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 27-282a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Gene Information

• Gene Name: IGFBP7 insulin-like growth factor binding protein 7 [ Homo sapiens ]
• Official Symbol: IGFBP7
• Synonyms: IGFBP7; insulin-like growth factor binding protein 7; insulin-like growth factor-binding protein 7; FSTL2; IGFBP 7; MAC25; PSF; IGFBP-rP1; angiomodulin; IGF-binding protein 7; PGI2-stimulating factor; tumor-derived adhesion factor; prostacyclin-stimulating factor; AGM; TAF; IBP-7; IGFBP-7; RAMSVPS; IGFBP-7v; IGFBPRP1
• Gene ID: 3490
• mRNA Refseq: NM_001253835
• Protein Refseq: NP_001240764
• MIM: 602867
• UniProt ID: Q16270