Recombinant Human IGFBP7 protein, His-tagged
Cat.No. : | IGFBP7-533H |
Product Overview : | Recombinant Human IGFBP7 protein(Q16270)(27-282aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-282a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL |
Gene Name | IGFBP7 insulin-like growth factor binding protein 7 [ Homo sapiens ] |
Official Symbol | IGFBP7 |
Synonyms | IGFBP7; insulin-like growth factor binding protein 7; insulin-like growth factor-binding protein 7; FSTL2; IGFBP 7; MAC25; PSF; IGFBP-rP1; angiomodulin; IGF-binding protein 7; PGI2-stimulating factor; tumor-derived adhesion factor; prostacyclin-stimulating factor; AGM; TAF; IBP-7; IGFBP-7; RAMSVPS; IGFBP-7v; IGFBPRP1; |
Gene ID | 3490 |
mRNA Refseq | NM_001253835 |
Protein Refseq | NP_001240764 |
MIM | 602867 |
UniProt ID | Q16270 |
◆ Recombinant Proteins | ||
IGFBP7-208H | Recombinant Human IGFBP7 protein | +Inquiry |
IGFBP7-1606H | Active Recombinant Human IGFBP7 protein, Fc-tagged | +Inquiry |
IGFBP7-12177Z | Recombinant Zebrafish IGFBP7 | +Inquiry |
Igfbp7-3490M | Recombinant Mouse Igfbp7 Protein, Myc/DDK-tagged | +Inquiry |
IGFBP7-5165H | Recombinant Human IGFBP7 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP7-1694HCL | Recombinant Human IGFBP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFBP7 Products
Required fields are marked with *
My Review for All IGFBP7 Products
Required fields are marked with *
0
Inquiry Basket