Recombinant Human IGFBP7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IGFBP7-6050H |
Product Overview : | IGFBP7 MS Standard C13 and N15-labeled recombinant protein (NP_001544) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm (PMID:21835307). |
Molecular Mass : | 28.9 kDa |
AA Sequence : | MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAELTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IGFBP7 insulin-like growth factor binding protein 7 [ Homo sapiens (human) ] |
Official Symbol | IGFBP7 |
Synonyms | IGFBP7; insulin-like growth factor binding protein 7; insulin-like growth factor-binding protein 7; FSTL2; IGFBP 7; MAC25; PSF; IGFBP-rP1; angiomodulin; IGF-binding protein 7; PGI2-stimulating factor; tumor-derived adhesion factor; prostacyclin-stimulating factor; AGM; TAF; IBP-7; IGFBP-7; RAMSVPS; IGFBP-7v; IGFBPRP1; |
Gene ID | 3490 |
mRNA Refseq | NM_001553 |
Protein Refseq | NP_001544 |
MIM | 602867 |
UniProt ID | Q16270 |
◆ Recombinant Proteins | ||
IGFBP7-1630H | Recombinant Human IGFBP7, His-tagged | +Inquiry |
IGFBP7-1606H | Active Recombinant Human IGFBP7 protein, Fc-tagged | +Inquiry |
IGFBP7-6957H | Active Recombinant Human IGFBP7 protein, His-tagged | +Inquiry |
IGFBP7-2483H | Recombinant human IGFBP7, His-tagged | +Inquiry |
IGFBP7-2281H | Recombinant Human IGFBP7 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP7-1694HCL | Recombinant Human IGFBP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFBP7 Products
Required fields are marked with *
My Review for All IGFBP7 Products
Required fields are marked with *