Recombinant Human IGHV3-23 Protein, His-tag

• Cat.No.: IGHV3-23-14H
• Product Overview: Recombinant Human IGHV3-23 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: IGHV3-23 belongs to a cluster of approximately 40 functional variable (V) genes in the immunoglobulin (Ig) heavy chain locus on chromosome 14.
• Form: Supplied as a 0.2 μm filtered solution in 20mM Tris, 150mM NaCl, pH8.0.
• Molecular Mass: ~13.8 KDa
• AA Sequence: MHHHHHHMSWVRQAPGKGLEWVSTIHGTSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASRGESTSNIKYWGQGTLVTVSSAAAEQKLISEEDLNSAAHYTDIEMNRLGKGAA
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.22 mg/ml

Gene Information

• Gene Name: IGHV3-23 immunoglobulin heavy variable 3-23 [ Homo sapiens (human) ]
• Official Symbol: IGHV3-23
• Synonyms: DP47; VH26; V3-23; IGHV323
• Gene ID: 28442
• MIM: 611939
• UniProt ID: P01764