Recombinant Human IGHV3-23 Protein, His-tag
| Cat.No. : | IGHV3-23-15H |
| Product Overview : | Recombinant Human IGHV3-23 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | IGHV3-23 belongs to a cluster of approximately 40 functional variable (V) genes in the immunoglobulin (Ig) heavy chain locus on chromosome 14. |
| Form : | Supplied as a 0.2 μm filtered solution in 20mM Tris, 150mM NaCl, pH8.0. |
| Molecular Mass : | ~13.9 KDa |
| AA Sequence : | MHHHHHHMAWVRQAPGKGLEWVSSISTRSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASRFGGQASFKYWGQGTLVTVSSAAAEQKLISEEDLNSAA HYTDIEMNRLGKGAA |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.11 mg/ml |
| Gene Name | IGHV3-23 immunoglobulin heavy variable 3-23 [ Homo sapiens (human) ] |
| Official Symbol | IGHV3-23 |
| Synonyms | DP47; VH26; V3-23; IGHV323 |
| Gene ID | 28442 |
| MIM | 611939 |
| UniProt ID | P01764 |
| ◆ Recombinant Proteins | ||
| IGHV3-23-15H | Recombinant Human IGHV3-23 Protein, His-tag | +Inquiry |
| IGHV3-23-14H | Recombinant Human IGHV3-23 Protein, His-tag | +Inquiry |
| IGHV3-23-31H | Recombinant Human IGHV3-23 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGHV3-23 Products
Required fields are marked with *
My Review for All IGHV3-23 Products
Required fields are marked with *



