Recombinant Human IGLL1 protein, T7/His-tagged

Cat.No. : IGLL1-107H
Product Overview : Recombinant human CD179b cDNA (38-213aa, Isoform-1, derived from BC012293) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 38-213 a.a.
Form : 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCW PRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQ GVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human B cell differentiation regulation study with this protein as coating or matrix protein.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name IGLL1 immunoglobulin lambda-like polypeptide 1 [ Homo sapiens ]
Official Symbol IGLL1
Synonyms IGLL1; immunoglobulin lambda-like polypeptide 1; IGLL; 14.1; CD179B; IGL5; IGVPB; lambda5; ig lambda-5; CD179b antigen; CD179 antigen-like family member B; Pre-B lymphocyte-specific protein-2; immunoglobulin-related 14.1 protein; immunoglobulin-related pr
Gene ID 3543
mRNA Refseq NM_020070
Protein Refseq NP_064455
MIM 146770
UniProt ID P15814
Chromosome Location 22q11.23
Pathway Primary immunodeficiency, organism-specific biosystem; Primary immunodeficiency, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGLL1 Products

Required fields are marked with *

My Review for All IGLL1 Products

Required fields are marked with *

0
cart-icon