Recombinant Human IGLL1 protein, T7/His-tagged

• Cat.No.: IGLL1-107H
• Product Overview: Recombinant human CD179b cDNA (38-213aa, Isoform-1, derived from BC012293) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 38-213 a.a.
• Form: 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCW PRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQ GVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human B cell differentiation regulation study with this protein as coating or matrix protein.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: IGLL1 immunoglobulin lambda-like polypeptide 1 [ Homo sapiens ]
• Official Symbol: IGLL1
• Synonyms: IGLL1; immunoglobulin lambda-like polypeptide 1; IGLL; 14.1; CD179B; IGL5; IGVPB; lambda5; ig lambda-5; CD179b antigen; CD179 antigen-like family member B; Pre-B lymphocyte-specific protein-2; immunoglobulin-related 14.1 protein; immunoglobulin-related pr
• Gene ID: 3543
• mRNA Refseq: NM_020070
• Protein Refseq: NP_064455
• MIM: 146770
• UniProt ID: P15814
• Chromosome Location: 22q11.23
• Pathway: Primary immunodeficiency, organism-specific biosystem; Primary immunodeficiency, conserved biosystem