Recombinant Human IGLL1 protein, T7/His-tagged
| Cat.No. : | IGLL1-107H |
| Product Overview : | Recombinant human CD179b cDNA (38-213aa, Isoform-1, derived from BC012293) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 38-213 a.a. |
| Form : | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEGLLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCW PRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQ GVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro human B cell differentiation regulation study with this protein as coating or matrix protein.2. May be used for protein-protein interaction assay development.3. As antigen for specific antibody production. |
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
| Gene Name | IGLL1 immunoglobulin lambda-like polypeptide 1 [ Homo sapiens ] |
| Official Symbol | IGLL1 |
| Synonyms | IGLL1; immunoglobulin lambda-like polypeptide 1; IGLL; 14.1; CD179B; IGL5; IGVPB; lambda5; ig lambda-5; CD179b antigen; CD179 antigen-like family member B; Pre-B lymphocyte-specific protein-2; immunoglobulin-related 14.1 protein; immunoglobulin-related pr |
| Gene ID | 3543 |
| mRNA Refseq | NM_020070 |
| Protein Refseq | NP_064455 |
| MIM | 146770 |
| UniProt ID | P15814 |
| Chromosome Location | 22q11.23 |
| Pathway | Primary immunodeficiency, organism-specific biosystem; Primary immunodeficiency, conserved biosystem; |
| ◆ Recombinant Proteins | ||
| IGLL1-7554H | Recombinant Human IGLL1, His-tagged | +Inquiry |
| IGLL1-4475M | Recombinant Mouse IGLL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Igll1-5647M | Recombinant Mouse Igll1 protein, His & T7-tagged | +Inquiry |
| IGLL1-1205H | Recombinant Human IGLL1 Protein (Leu29-Ser201), N-His tagged | +Inquiry |
| IGLL1-107H | Recombinant Human IGLL1 protein, T7/His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGLL1-5258HCL | Recombinant Human IGLL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGLL1 Products
Required fields are marked with *
My Review for All IGLL1 Products
Required fields are marked with *
