Recombinant Human IGSF21 Protein, GST-tagged
| Cat.No. : | IGSF21-4352H |
| Product Overview : | Human MGC15730 partial ORF ( NP_116269, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein which has two immunoglobulin (Ig) domains and is a member of the immunoglobulin superfamily. Proteins in this superfamily are usually found on or in cell membranes and act as receptors in immune response pathways. [provided by RefSeq, Sep 2011] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | ASSGPLQDSRPFRSLLHRDLDDTKMQKSLSLLDAENRGGRPYTERPSRGLTPDPNILLQPTTENIPETVVSREFPRWVHSAEPTYFLRHSRTPSSDGTVE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IGSF21 immunoglobin superfamily, member 21 [ Homo sapiens ] |
| Official Symbol | IGSF21 |
| Synonyms | IGSF21; immunoglobin superfamily, member 21; immunoglobulin superfamily member 21; MGC15730; RP11 121A23.1; FLJ41177; |
| Gene ID | 84966 |
| mRNA Refseq | NM_032880 |
| Protein Refseq | NP_116269 |
| UniProt ID | Q96ID5 |
| ◆ Recombinant Proteins | ||
| IGSF21-14124H | Recombinant Human IGSF21, His-tagged | +Inquiry |
| IGSF21-4479M | Recombinant Mouse IGSF21 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IGSF21-2223R | Recombinant Rhesus monkey IGSF21 Protein, His-tagged | +Inquiry |
| IGSF21-4352H | Recombinant Human IGSF21 Protein, GST-tagged | +Inquiry |
| IGSF21-8087M | Recombinant Mouse IGSF21 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGSF21-5256HCL | Recombinant Human IGSF21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGSF21 Products
Required fields are marked with *
My Review for All IGSF21 Products
Required fields are marked with *
