Recombinant Human IGSF21 Protein, GST-tagged

Cat.No. : IGSF21-4352H
Product Overview : Human MGC15730 partial ORF ( NP_116269, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which has two immunoglobulin (Ig) domains and is a member of the immunoglobulin superfamily. Proteins in this superfamily are usually found on or in cell membranes and act as receptors in immune response pathways. [provided by RefSeq, Sep 2011]
Molecular Mass : 36.74 kDa
AA Sequence : ASSGPLQDSRPFRSLLHRDLDDTKMQKSLSLLDAENRGGRPYTERPSRGLTPDPNILLQPTTENIPETVVSREFPRWVHSAEPTYFLRHSRTPSSDGTVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IGSF21 immunoglobin superfamily, member 21 [ Homo sapiens ]
Official Symbol IGSF21
Synonyms IGSF21; immunoglobin superfamily, member 21; immunoglobulin superfamily member 21; MGC15730; RP11 121A23.1; FLJ41177;
Gene ID 84966
mRNA Refseq NM_032880
Protein Refseq NP_116269
UniProt ID Q96ID5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGSF21 Products

Required fields are marked with *

My Review for All IGSF21 Products

Required fields are marked with *

0
cart-icon