Recombinant Human IKZF4 protein, His-tagged
Cat.No. : | IKZF4-6874H |
Product Overview : | Recombinant Human IKZF4 protein(268-457 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 268-457 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | ERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDST |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | IKZF4 IKAROS family zinc finger 4 (Eos) [ Homo sapiens ] |
Official Symbol | IKZF4 |
Synonyms | IKZF4; IKAROS family zinc finger 4 (Eos); zinc finger protein, subfamily 1A, 4 (Eos) , ZNFN1A4; zinc finger protein Eos; Eos; ikaros family zinc finger protein 4; zinc finger transcription factor Eos; zinc finger protein, subfamily 1A, 4 (Eos); EOS; ZNFN1A4; KIAA1782; |
Gene ID | 64375 |
mRNA Refseq | NM_022465 |
Protein Refseq | NP_071910 |
MIM | 606239 |
UniProt ID | Q9H2S9 |
◆ Recombinant Proteins | ||
IKZF4-4489M | Recombinant Mouse IKZF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
IKZF4-8107M | Recombinant Mouse IKZF4 Protein | +Inquiry |
IKZF4-6874H | Recombinant Human IKZF4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IKZF4-851HCL | Recombinant Human IKZF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IKZF4 Products
Required fields are marked with *
My Review for All IKZF4 Products
Required fields are marked with *