Recombinant Human IKZF4 protein, His-tagged

Cat.No. : IKZF4-6874H
Product Overview : Recombinant Human IKZF4 protein(268-457 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 268-457 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : ERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDST
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name IKZF4 IKAROS family zinc finger 4 (Eos) [ Homo sapiens ]
Official Symbol IKZF4
Synonyms IKZF4; IKAROS family zinc finger 4 (Eos); zinc finger protein, subfamily 1A, 4 (Eos) , ZNFN1A4; zinc finger protein Eos; Eos; ikaros family zinc finger protein 4; zinc finger transcription factor Eos; zinc finger protein, subfamily 1A, 4 (Eos); EOS; ZNFN1A4; KIAA1782;
Gene ID 64375
mRNA Refseq NM_022465
Protein Refseq NP_071910
MIM 606239
UniProt ID Q9H2S9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IKZF4 Products

Required fields are marked with *

My Review for All IKZF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon