Recombinant Human IKZF5 Protein, N-His6ABP tagged
Cat.No. : | IKZF5-12H |
Product Overview : | Recombinant Human IKZF5 Protein with N-His6ABP tag (ABP = Albumin Binding Protein derived from Streptococcal Protein G) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | ABP&His |
Description : | Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Pegasus, are expressed in lymphocytes and are implicated in the control of lymphoid development. |
Molecular Mass : | 28 kDa including tags |
AA Sequence : | IKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQL |
Purity : | >80% by SDS-PAGE and Coomassie blue staining |
Applications : | Blocking agent and positive assay control using corresponding antibodies. |
Usage : | Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. |
Notes : | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Storage : | Upon delivery store at -20 centigrade. Avoid repeated freeze/thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS and 1M Urea, pH 7.4. |
Shipping : | Shipped in liquid form on wet ice. |
Gene Name | IKZF5 IKAROS family zinc finger 5 [ Homo sapiens (human) ] |
Official Symbol | IKZF5 |
Synonyms | IKZF5; IKAROS family zinc finger 5; THC7; PEGASUS; ZNFN1A5; zinc finger protein Pegasus; zinc finger protein, subfamily 1A, 5 (Pegasus); zinc finger transcription factor Pegasus |
Gene ID | 64376 |
mRNA Refseq | NM_001271840 |
Protein Refseq | NP_001258769 |
MIM | 606238 |
UniProt ID | Q9H5V7 |
◆ Recombinant Proteins | ||
IKZF5-12H | Recombinant Human IKZF5 Protein, N-His6ABP tagged | +Inquiry |
IKZF5-2048R | Recombinant Rhesus Macaque IKZF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
IKZF5-8108M | Recombinant Mouse IKZF5 Protein | +Inquiry |
IKZF5-11639Z | Recombinant Zebrafish IKZF5 | +Inquiry |
IKZF5-3235C | Recombinant Chicken IKZF5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IKZF5-5250HCL | Recombinant Human IKZF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IKZF5 Products
Required fields are marked with *
My Review for All IKZF5 Products
Required fields are marked with *