Recombinant Human IKZF5 Protein, N-His6ABP tagged

• Cat.No.: IKZF5-12H
• Product Overview: Recombinant Human IKZF5 Protein with N-His6ABP tag (ABP = Albumin Binding Protein derived from Streptococcal Protein G) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: ABP&His
• Description: Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Pegasus, are expressed in lymphocytes and are implicated in the control of lymphoid development.
• Molecular Mass: 28 kDa including tags
• AA Sequence: IKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQL
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Applications: Blocking agent and positive assay control using corresponding antibodies.
• Usage: Suitable as control in WB and preadsorption assays using indicated corresponding antibodies.
• Notes: Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
• Storage: Upon delivery store at -20 centigrade. Avoid repeated freeze/thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS and 1M Urea, pH 7.4.
• Shipping: Shipped in liquid form on wet ice.

Gene Information

• Gene Name: IKZF5 IKAROS family zinc finger 5 [ Homo sapiens (human) ]
• Official Symbol: IKZF5
• Synonyms: IKZF5; IKAROS family zinc finger 5; THC7; PEGASUS; ZNFN1A5; zinc finger protein Pegasus; zinc finger protein, subfamily 1A, 5 (Pegasus); zinc finger transcription factor Pegasus
• Gene ID: 64376
• mRNA Refseq: NM_001271840
• Protein Refseq: NP_001258769
• MIM: 606238
• UniProt ID: Q9H5V7