Recombinant Human IL-35 Heterodimer Protein

Cat.No. : EBI3-72H
Product Overview : Recombinant Human IL-35 Heterodimer Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Description : Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the p35 subunit (IL-12A) and the Epstein-Barr virus induced gene 3 subunit (EBI3/IL-27B). IL-35 binds the IL-12Rbeta2/gp130 hetero- and homodimers to activate STAT1 and STAT4 signaling. IL-35 functions as a suppressor of immune cell inflammatory responses.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Single chain dimer, 45.8/ 60-65 unreduced 70-80 reduced kDa (406 aa)
AA Sequence : EBI3: RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
p35: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Endotoxin : ≤5 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 30 mM sodium chloride, pH7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Ice pack
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name EBI3 Epstein-Barr virus induced 3 [ Homo sapiens (human) ]
Official Symbol EBI3
Synonyms EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B;
Gene ID 10148
mRNA Refseq NM_005755
Protein Refseq NP_005746
MIM 605816
UniProt ID Q14213

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EBI3 Products

Required fields are marked with *

My Review for All EBI3 Products

Required fields are marked with *

0
cart-icon
0
compare icon