Recombinant Human IL-35 Heterodimer Protein
Cat.No. : | EBI3-72H |
Product Overview : | Recombinant Human IL-35 Heterodimer Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Description : | Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the p35 subunit (IL-12A) and the Epstein-Barr virus induced gene 3 subunit (EBI3/IL-27B). IL-35 binds the IL-12Rbeta2/gp130 hetero- and homodimers to activate STAT1 and STAT4 signaling. IL-35 functions as a suppressor of immune cell inflammatory responses. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Single chain dimer, 45.8/ 60-65 unreduced 70-80 reduced kDa (406 aa) |
AA Sequence : | EBI3: RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK p35: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
Endotoxin : | ≤5 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 30 mM sodium chloride, pH7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Ice pack |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | EBI3 Epstein-Barr virus induced 3 [ Homo sapiens (human) ] |
Official Symbol | EBI3 |
Synonyms | EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B; |
Gene ID | 10148 |
mRNA Refseq | NM_005755 |
Protein Refseq | NP_005746 |
MIM | 605816 |
UniProt ID | Q14213 |
◆ Recombinant Proteins | ||
EBI3-27028TH | Recombinant Human EBI3, His-tagged | +Inquiry |
EBI3-504H | Active Recombinant Human Epstein-Barr Virus Induced 3 | +Inquiry |
EBI3-45H | Recombinant Human EBI3 | +Inquiry |
Ebi3-239M | Active Recombinant Mouse Ebi3 Protein (Ala23-Pro228), C-His tagged, Animal-free, Carrier-free | +Inquiry |
EBI3-2233H | Recombinant Human EBI3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EBI3 Products
Required fields are marked with *
My Review for All EBI3 Products
Required fields are marked with *
0
Inquiry Basket