Recombinant Human IL10RA protein(291-370 aa), C-His-tagged
Cat.No. : | IL10RA-2859H |
Product Overview : | Recombinant Human IL10RA protein(Q13651)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 291-370 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDS |
Gene Name | IL10RA interleukin 10 receptor, alpha [ Homo sapiens ] |
Official Symbol | IL10RA |
Synonyms | IL10RA; interleukin 10 receptor, alpha; IL10R; interleukin-10 receptor subunit alpha; CD210; CD210a; CDW210A; HIL 10R; IL-10RA; IL-10R subunit 1; IL-10R subunit alpha; IL-10 receptor subunit alpha; interleukin-10 receptor subunit 1; interleukin-10 receptor alpha chain; HIL-10R; IL-10R1; |
Gene ID | 3587 |
mRNA Refseq | NM_001558 |
Protein Refseq | NP_001549 |
MIM | 146933 |
UniProt ID | Q13651 |
◆ Recombinant Proteins | ||
Il10ra-1234M | Recombinant Mouse Il10ra Protein, MYC/DDK-tagged | +Inquiry |
IL10RA-988R | Active Recombinant Rhesus IL10RA Protein (Thr9-Asn245), His-tagged | +Inquiry |
IL10RA-214M | Recombinant Mouse IL10RA protein, Fc-tagged | +Inquiry |
IL10RA-001H | Active Recombinant Human IL10RA Protein | +Inquiry |
IL10RA-02H | Active Recombinant human IL10RA Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10RA-1185CCL | Recombinant Cynomolgus IL10RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10RA Products
Required fields are marked with *
My Review for All IL10RA Products
Required fields are marked with *
0
Inquiry Basket