Recombinant Human IL10RA protein(291-370 aa), C-His-tagged

• Cat.No.: IL10RA-2859H
• Product Overview: Recombinant Human IL10RA protein(Q13651)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 291-370 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDS

Gene Information

• Gene Name: IL10RA interleukin 10 receptor, alpha [ Homo sapiens ]
• Official Symbol: IL10RA
• Synonyms: IL10RA; interleukin 10 receptor, alpha; IL10R; interleukin-10 receptor subunit alpha; CD210; CD210a; CDW210A; HIL 10R; IL-10RA; IL-10R subunit 1; IL-10R subunit alpha; IL-10 receptor subunit alpha; interleukin-10 receptor subunit 1; interleukin-10 receptor alpha chain; HIL-10R; IL-10R1
• Gene ID: 3587
• mRNA Refseq: NM_001558
• Protein Refseq: NP_001549
• MIM: 146933
• UniProt ID: Q13651