Recombinant Human IL10RA protein(291-370 aa), C-His-tagged

Cat.No. : IL10RA-2859H
Product Overview : Recombinant Human IL10RA protein(Q13651)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 291-370 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDS
Gene Name IL10RA interleukin 10 receptor, alpha [ Homo sapiens ]
Official Symbol IL10RA
Synonyms IL10RA; interleukin 10 receptor, alpha; IL10R; interleukin-10 receptor subunit alpha; CD210; CD210a; CDW210A; HIL 10R; IL-10RA; IL-10R subunit 1; IL-10R subunit alpha; IL-10 receptor subunit alpha; interleukin-10 receptor subunit 1; interleukin-10 receptor alpha chain; HIL-10R; IL-10R1;
Gene ID 3587
mRNA Refseq NM_001558
Protein Refseq NP_001549
MIM 146933
UniProt ID Q13651

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10RA Products

Required fields are marked with *

My Review for All IL10RA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon