Recombinant Human IL10RA protein(291-370 aa), C-His-tagged
| Cat.No. : | IL10RA-2859H |
| Product Overview : | Recombinant Human IL10RA protein(Q13651)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 291-370 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDS |
| Gene Name | IL10RA interleukin 10 receptor, alpha [ Homo sapiens ] |
| Official Symbol | IL10RA |
| Synonyms | IL10RA; interleukin 10 receptor, alpha; IL10R; interleukin-10 receptor subunit alpha; CD210; CD210a; CDW210A; HIL 10R; IL-10RA; IL-10R subunit 1; IL-10R subunit alpha; IL-10 receptor subunit alpha; interleukin-10 receptor subunit 1; interleukin-10 receptor alpha chain; HIL-10R; IL-10R1; |
| Gene ID | 3587 |
| mRNA Refseq | NM_001558 |
| Protein Refseq | NP_001549 |
| MIM | 146933 |
| UniProt ID | Q13651 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10RA Products
Required fields are marked with *
My Review for All IL10RA Products
Required fields are marked with *



