Recombinant Human IL11 therapeutic protein(Oprelvekin)
Cat.No. : | IL11-P012H |
Product Overview : | Recombinant Interleukin eleven, which is produced in Escherichia coli (E. coli) by recombinant DNA technology, has a molecular mass of approximately 19,000 daltons, and is non-glycosylated. The polypeptide is 177 amino acids in length (the natural IL-11 has 178). This alteration has not resulted in measurable differences in bioactivity either in vitro or in vivo. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 177aa |
Description : | The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. The expression product is the active ingredient of Neumega. |
Molecular Mass : | 19kDa |
AA Sequence : | GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGV LTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPP SSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
Purity : | >95% |
Alias : | IL11; AGIF; IL 11; IL-11; Oprelvekin |
Gene Name | IL11 interleukin 11 [ Homo sapiens ] |
Official Symbol | IL11 |
Synonyms | IL11; interleukin 11; interleukin-11; adipogenesis inhibitory factor; AGIF; IL 11; oprelvekin; IL-11; |
Gene ID | 3589 |
mRNA Refseq | NM_000641 |
Protein Refseq | NP_000632 |
MIM | 147681 |
UniProt ID | P20809 |
Chromosome Location | 19q13.3-q13.4 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; Rheumatoid arthritis, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; interleukin-11 receptor binding; |
◆ Recombinant Proteins | ||
Il11-1659R | Recombinant Rat Il11 Protein, His-tagged | +Inquiry |
IL11-4299H | Recombinant Human IL11 Protein (Met1-Leu199), C-His tagged | +Inquiry |
IL11-2016H | Recombinant Human IL11 Protein, Met-tagged | +Inquiry |
Il11-1373M | Recombinant Mouse Il11 protein, MBP&His-Avi-tagged, Biotinylated | +Inquiry |
IL11-259I | Active Recombinant Human IL11 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL11-5249HCL | Recombinant Human IL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL11 Products
Required fields are marked with *
My Review for All IL11 Products
Required fields are marked with *
0
Inquiry Basket