Recombinant Human IL12B protein, His-tagged
| Cat.No. : | IL12B-3433H |
| Product Overview : | Recombinant Human IL12B protein(P29460)(23-328aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 23-328aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.8 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Gene Name | IL12B interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) [ Homo sapiens ] |
| Official Symbol | IL12B |
| Synonyms | IL12B; interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40); NKSF2; interleukin-12 subunit beta; CLMF; CLMF2; cytotoxic lymphocyte maturation factor 2; p40; IL 12B; IL12; subunit p40; interleukin 12; interleukin 12 beta chain; natural killer cell stimulatory factor; 40 kD subunit; natural killer cell stimulatory factor 2; NKSF; CLMF p40; IL-12 subunit p40; IL12, subunit p40; interleukin 12, p40; interleukin-12 beta chain; NK cell stimulatory factor chain 2; cytotoxic lymphocyte maturation factor 40 kDa subunit; natural killer cell stimulatory factor, 40 kD subunit; IL-12B; |
| Gene ID | 3593 |
| mRNA Refseq | NM_002187 |
| Protein Refseq | NP_002178 |
| MIM | 161561 |
| UniProt ID | P29460 |
| ◆ Recombinant Proteins | ||
| IL12B-43H | Recombinant Human IL12B, His-tagged | +Inquiry |
| Il12b-847M | Recombinant Mouse Il12b protein, His & T7-tagged | +Inquiry |
| IL12B-5038G | Recombinant Goat IL12B protein | +Inquiry |
| IL12B-846H | Recombinant Horse IL12B protein, His & T7-tagged | +Inquiry |
| Il12b-5694M | Recombinant Mouse Il12b Protein (Met23-Ser335), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL12B-1197RCL | Recombinant Rat IL12B cell lysate | +Inquiry |
| IL12B-1000MCL | Recombinant Marmoset IL12B cell lysate | +Inquiry |
| IL12B-1101MCL | Recombinant Mouse IL12B cell lysate | +Inquiry |
| IL12B-2731HCL | Recombinant Human IL12B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12B Products
Required fields are marked with *
My Review for All IL12B Products
Required fields are marked with *
