Recombinant Human IL12RB1 Protein, His-tagged

Cat.No. : IL12RB1-074H
Product Overview : Recombinant Human IL12RB1 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.
Molecular Mass : ~52 kDa
AA Sequence : CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name IL12RB1 interleukin 12 receptor, beta 1 [ Homo sapiens (human) ]
Official Symbol IL12RB1
Synonyms IL12RB1; interleukin 12 receptor, beta 1; IL12RB; interleukin-12 receptor subunit beta-1; CD212; IL-12RB1; IL-12R-beta-1; IL-12R subunit beta-1; IL-12 receptor beta component; IL-12 receptor subunit beta-1; interleukin-12 receptor beta-1 chain; IL-12R-BETA1; MGC34454;
Gene ID 3594
mRNA Refseq NM_005535
Protein Refseq NP_005526
MIM 601604
UniProt ID P42701

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL12RB1 Products

Required fields are marked with *

My Review for All IL12RB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon