Recombinant Human IL13RA2
| Cat.No. : | IL13RA2-28498TH |
| Product Overview : | Recombinant fragment of Human IL13 receptor alpha 2 with N terminal proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET |
| Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 5 subfamily.Contains 1 fibronectin type-III domain. |
| Gene Name | IL13RA2 interleukin 13 receptor, alpha 2 [ Homo sapiens ] |
| Official Symbol | IL13RA2 |
| Synonyms | IL13RA2; interleukin 13 receptor, alpha 2; interleukin-13 receptor subunit alpha-2; cancer/testis antigen 19; CD213a2; CT19; IL 13R; IL13BP; |
| Gene ID | 3598 |
| mRNA Refseq | NM_000640 |
| Protein Refseq | NP_000631 |
| MIM | 300130 |
| Uniprot ID | Q14627 |
| Chromosome Location | Xq13.1-q28 |
| Pathway | IL4-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
| Function | cytokine receptor activity; receptor activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| Il13ra2-1056MAF555 | Active Recombinant Mouse Il13ra2 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| Il13ra2-1739M | Recombinant Mouse Il13ra2 protein, His-tagged | +Inquiry |
| IL13RA2-6368Z | Recombinant Zebrafish IL13RA2 | +Inquiry |
| Il13ra2-7459R | Recombinant Rat Il13ra2 protein(Met1-Lys336), His-tagged | +Inquiry |
| IL13RA2-731H | Recombinant Human IL13RA2 protein, His-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL13RA2-896CCL | Recombinant Canine IL13RA2 cell lysate | +Inquiry |
| IL13RA2-2758MCL | Recombinant Mouse IL13RA2 cell lysate | +Inquiry |
| IL13RA2-2921HCL | Recombinant Human IL13RA2 cell lysate | +Inquiry |
| IL13RA2-1260RCL | Recombinant Rat IL13RA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL13RA2 Products
Required fields are marked with *
My Review for All IL13RA2 Products
Required fields are marked with *
