Recombinant Human IL15RA
Cat.No. : | IL15RA-28598TH |
Product Overview : | Recombinant fragment corresponding to amino acids 31-130 of Human IL15RA with an N terminal proprietary tag, 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15R |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA |
Sequence Similarities : | Contains 1 Sushi (CCP/SCR) domain. |
Gene Name | IL15RA interleukin 15 receptor, alpha [ Homo sapiens ] |
Official Symbol | IL15RA |
Synonyms | IL15RA; interleukin 15 receptor, alpha; interleukin-15 receptor subunit alpha; CD215; IL 15RA; |
Gene ID | 3601 |
mRNA Refseq | NM_001243539 |
Protein Refseq | NP_001230468 |
MIM | 601070 |
Uniprot ID | Q13261 |
Chromosome Location | 10p15.1 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Intestinal immune network for IgA production, organism-specific biosystem; |
Function | cytokine receptor activity; protein binding; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
IL15RA-1074H | Recombinant Human IL15RA protein(Ile31-Thr205), His-tagged | +Inquiry |
IL15RA-4677H | Recombinant Human IL15RA Protein, hFc-tagged, Site-specific PE-Labeled | +Inquiry |
IL15RA-273HB | Recombinant Human IL15RA protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL15RA-4310H | Recombinant Human IL15RA Protein (Met1-Thr205), C-Fc tagged | +Inquiry |
IL15RA-1653H | Recombinant Human Interleukin 15 Receptor, Alpha, Fc-His | +Inquiry |
◆ Native Proteins | ||
IL15RA-73M | Active Recombinant Mouse IL15RA Protein, His-tagged | +Inquiry |
IL15RA-49H | Active Recombinant Human IL15RA Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15RA-5246HCL | Recombinant Human IL15RA Overexpression Lysate(Ile31-Thr205) | +Inquiry |
IL15RA-5247HCL | Recombinant Human IL15RA Overexpression Lysate(Ile31-Asp96&Asn49-Ser162) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL15RA Products
Required fields are marked with *
My Review for All IL15RA Products
Required fields are marked with *