Recombinant Human IL19 Protein, His-tagged

Cat.No. : IL19-03H
Product Overview : Recombinant human IL-19 (25-177aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 25-177aa
Description : The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.
Form : Liquid
Molecular Mass : 19.1 kDa (164aa)
AA Sequence : LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name IL19 interleukin 19 [ Homo sapiens (human) ]
Official Symbol IL19
Synonyms IL19; interleukin 19; MDA1; NG.1; ZMDA1; IL-10C; interleukin-19; melanoma differentiation associated protein-like protein
Gene ID 29949
mRNA Refseq NM_013371
Protein Refseq NP_037503
MIM 605687
UniProt ID Q9UHD0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL19 Products

Required fields are marked with *

My Review for All IL19 Products

Required fields are marked with *

0
cart-icon
0
compare icon