Recombinant Human IL19 Protein, His-tagged

• Cat.No.: IL19-03H
• Product Overview: Recombinant human IL-19 (25-177aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 25-177aa
• Description: The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.
• Form: Liquid
• Molecular Mass: 19.1 kDa (164aa)
• AA Sequence: LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: IL19 interleukin 19 [ Homo sapiens (human) ]
• Official Symbol: IL19
• Synonyms: IL19; interleukin 19; MDA1; NG.1; ZMDA1; IL-10C; interleukin-19; melanoma differentiation associated protein-like protein
• Gene ID: 29949
• mRNA Refseq: NM_013371
• Protein Refseq: NP_037503
• MIM: 605687
• UniProt ID: Q9UHD0