Recombinant Human IL1B Protein
| Cat.No. : | IL1B-69H |
| Product Overview : | Recombinant Human Interleukin-1 beta is produced by our E.coli expression system and the target gene encoding Ala117-Ser269 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | Ala117-Ser269 |
| Description : | IL1B belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
| Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl, pH7.4. |
| AA Sequence : | MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEK NLYLSCVLKDDKPTLQ LESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQ FVSS |
| Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
| Purity : | >95% |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
| Gene Name | IL1B interleukin 1 beta [ Homo sapiens (human) ] |
| Official Symbol | IL1B |
| Synonyms | Interleukin-1 beta; Catabolin; IL1F2; IL1B; IL-1; IL1beta; IL1-BETA |
| Gene ID | 3553 |
| mRNA Refseq | NM_000576.3 |
| Protein Refseq | NP_000567.1 |
| MIM | 147720 |
| UniProt ID | P01584 |
| ◆ Recombinant Proteins | ||
| Il1b-93R | Recombinant Rat Il1b protein | +Inquiry |
| il1b-2298Z | Active Recombinant Zebrafish il1b protein, His-tagged | +Inquiry |
| Il1b-55M | Active Recombinant Mouse Il1b Protein (Val118-Ser269), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| IL1B-6093C | Recombinant Chicken IL1B | +Inquiry |
| IL1B-250I | Active Recombinant Human IL1B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
