Recombinant Human IL2/diphtheria toxin, His-tagged therapeutic protein(Denileukin diftitox)
| Cat.No. : | diphtheria toxin&IL2-P031H |
| Product Overview : | A recombinant DNA-derived cytotoxic protein composed of the amino acid sequences for diphtheria toxin fragments A and B (Met 1-Thr 387)-His followed by the sequences for interleukin-2 (IL-2; Ala 1-Thr 133). It is produced in an E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | diphtheria toxin fragments A and B (Met 1-Thr 387); IL-2(la 1-Thr 133) |
| Description : | The expression product is the active ingredient of Ontak. |
| Molecular Mass : | 57.6 kDa |
| AA Sequence : | MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNE NPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFA EGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDK TKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAV NVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIG FAAYNFVESIINLFQVVHNSYNRPAYSPGHKTHAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNP KLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMC EYADETATIVEFLNRWITFCQSIISTLT |
| Endotoxin : | < 1.0 EU per μg of the protein |
| Purity : | >95% |
| Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
| Alias : | IL2; IL 2; TCGF; IL-2; Denileukin diftitox |
| Gene Name | IL2 interleukin 2 [ Homo sapiens ] |
| Official Symbol | IL2 |
| Synonyms | IL2; interleukin 2; interleukin-2; IL 2; T cell growth factor; TCGF; aldesleukin; involved in regulation of T-cell clonal expansion; IL-2; lymphokine; |
| Gene ID | 3558 |
| mRNA Refseq | NM_000586 |
| Protein Refseq | NP_000577 |
| MIM | 147680 |
| UniProt ID | P60568 |
| Chromosome Location | 4q26-q27 |
| Pathway | Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; |
| Function | carbohydrate binding; cytokine activity; glycosphingolipid binding; growth factor activity; interleukin-2 receptor binding; interleukin-2 receptor binding; kappa-type opioid receptor binding; kinase activator activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *



